[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07863.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dokB.bssp"

## Summary of PDB Search
:179
    4e-07  13%  2dokB  [x.x.x] TELOMERASE-BINDING PROTEIN EST1A
:179

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxGPDAGALSVTSAPRVVLDSNIWVDLLVFRDPHVEXXXXXXXXXXXXXXXXXDCREE
2dokB           --------------GSPEFMELEIRPLFLVPDTNGFID-------HLASLARLLESRKYILVVPLIVINE


                         .         .         *         .         .         .         .:140
query           LRRVLAYPQFTRFAVDIDAALAEVDRFTTLEPVPTQEDADAIRLPKCKDTDDQKFIELAHFSRAALLVSK
2dokB           LDGLAKGAGGYEKARKSIEFLEQESRDSCLRALTSRGNELESIAFRSEDNNDDLILSCCLHYCKDKAKDF


                         +         .         .         .         .         *         .:210
query           DKAVXXXXXXXXXXXGVEVLPPLAFGGWLxxxxxxxxxx
2dokB           MPPIDRNLRVKALTRNVPVRDIPAFLTWA----------