[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07913.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2apnA.bssp"
#ERROR : Can't open dsspfile "2d2aA.bssp"
#ERROR : Can't open dsspfile "2d2aB.bssp"

## Summary of PDB Search
:113
    1e-30  29%  2apnA  [x.x.x] PROTEIN HI1723
    1e-30  40%  2d2aA  [x.x.x] SUFA PROTEIN
    1e-22  36%  2d2aB  [x.x.x] SUFA PROTEIN
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFDSKAKMISMTEKAAKHVARYLEXXXXXXXXXXXXXXXXCSGLAYKLEYVDEVLPEDQVFETHGIKVIV
2apnA           MIDDMAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVI
2d2aA           --DFAWQGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFV
2d2aB           --QDFAWQLTLTPAAAIHIRELVAKQPGMVGVRLGV----KQGFGYVLDSVSEPDKDDLLFEHDGAKLFV


                         .         .         *         .         .         .         .:140
query           DPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV
2apnA           DPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI
2d2aA           PLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV
2d2aB           PLQAMPFIDGTEVDFVREGLNQIFKFHNPK-------------