[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07921.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "1dj2A.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "2e6hD.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "3ce6B.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "2e6bD.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "1bmdA.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "3ce6A.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "1cg4A.bssp"
#ERROR : Can't open dsspfile "2e37D.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "1d4gA.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "2e6bC.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "2e6cC.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "1cg1A.bssp"
#ERROR : Can't open dsspfile "2e37C.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "3dxfB.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "3ce6D.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2e6hC.bssp"
#ERROR : Can't open dsspfile "2e6cD.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "2aw5B.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "3c6cA.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "2eggA.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "2e37A.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "2e6gB.bssp"
#ERROR : Can't open dsspfile "2e6gK.bssp"
#ERROR : Can't open dsspfile "3d64A.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "3dooA.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "3c2qA.bssp"
#ERROR : Can't open dsspfile "1b3rA.bssp"
#ERROR : Can't open dsspfile "3donA.bssp"
#ERROR : Can't open dsspfile "3dfzA.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "1c9kB.bssp"
#ERROR : Can't open dsspfile "3c2qB.bssp"
#ERROR : Can't open dsspfile "1d4fA.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "2e6gA.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "1di7A.bssp"
#ERROR : Can't open dsspfile "1a7aA.bssp"
#ERROR : Can't open dsspfile "2e37B.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "2aw5C.bssp"
#ERROR : Can't open dsspfile "1cg3A.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "2e6eD.bssp"
#ERROR : Can't open dsspfile "1a7aB.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "1cbuC.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "3e6vA.bssp"
#ERROR : Can't open dsspfile "3cq0B.bssp"
#ERROR : Can't open dsspfile "2e6gJ.bssp"
#ERROR : Can't open dsspfile "1c9yA.bssp"
#ERROR : Can't open dsspfile "3dtdB.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "3e9nB.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "2e6hB.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"

## Summary of PDB Search
:256
    3e-14  17%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    7e-14  17%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    7e-14  27%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    3e-13  19%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    9e-13  15%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-13  17%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-12  16%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-12  13%  1dj2A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    3e-12  16%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    4e-12   8%  2e6hD  [x.x.x] 5'-NUCLEOTIDASE SURE
    5e-12   8%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    6e-12  14%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    6e-12  19%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-11   6%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    2e-11  13%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-11  18%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-11  10%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-11   7%  3ce6B  [x.x.x] ADENOSYLHOMOCYSTEINASE
    6e-11  15%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-10  10%  2e6bD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-10  13%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    3e-10  24%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    6e-10   8%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    6e-10  16%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-10  15%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    7e-10   6%  1bmdA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    8e-10  19%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-10  19%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-09  10%  3ce6A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    1e-09  15%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-09  23%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    2e-09  15%  1cg4A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    3e-09  12%  2e37D  [x.x.x] L-LACTATE DEHYDROGENASE
    4e-09  20%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-09   8%  1d4gA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    4e-09  12%  1di6A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    5e-09  10%  2e6bC  [x.x.x] 5'-NUCLEOTIDASE SURE
    5e-09   4%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    6e-09   9%  2e6cC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-08  15%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-08  19%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    3e-08  13%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    4e-08  18%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    4e-08  13%  1cg1A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    4e-08  13%  2e37C  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-07  14%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    1e-07  25%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    1e-07   7%  3dxfB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    2e-07  21%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-07   6%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-07  14%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-07   8%  3ce6D  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-07  20%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    2e-07  10%  2e6hC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-07   9%  2e6cD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-07  18%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    3e-07  12%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    3e-07  19%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-07  10%  2aw5B  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    4e-07   7%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    4e-07  23%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    4e-07  10%  3c6cA  [x.x.x] 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME
    4e-07  15%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    6e-07  17%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-07   5%  2eggA  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    7e-07  13%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    7e-07  12%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-07  22%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-07  14%  2e37A  [x.x.x] L-LACTATE DEHYDROGENASE
    9e-07  19%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-06  16%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-06   8%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-06  10%  2e6gB  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-06   7%  2e6gK  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-06   8%  3d64A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-06  21%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-06  19%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    2e-06   3%  3dooA  [x.x.x] SHIKIMATE DEHYDROGENASE
    2e-06  20%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-06  15%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    2e-06  13%  3c2qA  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    3e-06   7%  1b3rA  [c.23.12 - c.2.1] PROTEIN (S-ADENOSYLHOMOCYSTEINE HYDROLASE)
    3e-06   3%  3donA  [x.x.x] SHIKIMATE DEHYDROGENASE
    3e-06   5%  3dfzA  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    4e-06  20%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-06  17%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    5e-06  21%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-05   8%  1c9kB  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    1e-05  13%  3c2qB  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    1e-05  10%  1d4fA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    1e-05  14%  1dhrA  [c.2.1 (1dirA)] DIHYDROPTERIDINE REDUCTASE
    1e-05  10%  2e6gA  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-05  11%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    1e-05  12%  1di7A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    2e-05  10%  1a7aA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    2e-05  12%  2e37B  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-05  13%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    2e-05  15%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-05  13%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-05   8%  2aw5C  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    3e-05  12%  1cg3A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    3e-05  23%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-05   9%  1adeA  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    6e-05  15%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    6e-05  12%  2e6eD  [x.x.x] 5'-NUCLEOTIDASE SURE
    8e-05  11%  1a7aB  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    1e-04  20%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-04  26%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    2e-04  16%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-04  12%  1cbuC  [c.37.1] ADENOSYLCOBINAMIDE KINASE/ADENOSYLCOBINAMIDE
    2e-04   6%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    2e-04   7%  1a9yA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    2e-04   9%  3e6vA  [x.x.x] ARGINASE-1
    2e-04  11%  3cq0B  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    2e-04  11%  2e6gJ  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-04   7%  1c9yA  [c.78.1 - c.78.1] ORNITHINE CARBAMOYLTRANSFERASE
    3e-04  13%  3dtdB  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    3e-04  20%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-04  15%  3e9nB  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    5e-04  14%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    6e-04  11%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    6e-04   8%  2e6hB  [x.x.x] 5'-NUCLEOTIDASE SURE
    6e-04  17%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNRVIGVARSRNPELEAEATASGVRVAWHLQDLSQPGP
3dwfA           ----------------------------------HVVVTARSKEALQKVVARCLELGAASAHYIAGSMED
3dwfC           ----------------------------------HVVVTARSKEALQKVVARCLELGAASAHYIAGSMED
3deyX           ----------------------------------------------------------------------
1a27A           ---------------------------------------------EAARALACPPGSLETLQLDVRDS--
3ch6E           ----------------------------------HVVVTAR-SKETLQKVVSHCLELGAASAHYIAGTME
3d5qC           ----------------------------------HVVVTARSKETLQKVVSHLGAASAHYIAGTMEDM--
3d3eA           ---------------------------------------------VVSHCLELGAASAHYIAGTMEDM--
1dj2A           ----------------------------------------------------------------------
2ae1A           ----------------------------------SVYTCSRNQKEDCLTQWRSKGFKVEASVCDLSSR--
2e6hD           ----------------------------------RILVTNDDGIYSPGLWALA---------EAASQFGE
1a9zA           ----------------------------------------------------------------------
1dohB           ----------------------------------KVIVNYANSTEEEVVAAIKKNGSDAACVKANVG---
2d1yB           ----------------------------------LVALCDLRP-EGKEVAEAIGGAFFQVDLEDERER--
1b8pA           -----------------------------------GKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFP
2belC           ----------------------------------HVVVTARSKETLQKVVSHCLELGAASAHY-IAGTME
3czrA           ----------------------------------HVVVTARSKETLQKVCLELGAASAHYIAGTMEDMTF
2b35E           ---------------------------------AQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
3ce6B           ----------------------------------------------------------------------
2belA           ----------------------------------HVVVTARSKETLQKVCLELGAASAHYIAGTMEDMT-
2e6bD           ----------------------------------RILVTNDDGIYSPGLWALAQFGEVFVAAPDTHAIT-
3bmoB           ----------------------------------RVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLT
2ehdA           ----------------------------------RVGLMARDEKR---LQALAAELEGALPLPDVREEG-
3bhmA           ----------------------------------------------------------------------
3bzuB           ---------------------------------------------VVSHCLELGAASAHYIAGTMEDM--
2ag5A           ----------------------------------KVIATDINES---KLQELEKYPGIQTRVLDVTKK--
1bmdA           ----------------------------------LGKDQPVILLEIPQAMKALEGVVMELEDCAFP----
2belD           ----------------------------------------------------------------------
3edmC           ------------------------------------------------AEIEKLGRSALAIKADLTN---
3ce6A           ----------------------------------RVSVTEIDPINALQAFDVVTVEEAIGDADIVVTAT-
2ag5C           ----------------------------------KVIATDINESK---LQELEKYPGIQTRVLDVTKK--
2ehdB           ----------------------------------------------------------------------
1cg4A           ----------------------------------------------------------------------
2e37D           ----------------------------------------------------------------------
3d4nC           ----------------------------------------------------------------------
1d4gA           ----------------------------------------------------------------------
1di6A           -----------------------------------SISDRDKGIPALEEWLTSALTTPFELETR--LIPD
2e6bC           ----------------------------------RILVTNDDGIYSPGLWALAQFGEVFVAAPDTHAITI
2cnbB           ------------------------------------VETRENVARKLQQSDGPKPPWADRYAALEVGD--
2e6cC           ----------------------------------RILVTNDDGIYSPGLWALAQFGEVFVAAPDTEQS--
3dwfB           ----------------------------------------------------------------------
2cfcA           ----------------------------------RVAALDLSAETLEETHWHAYADKVLRVRADVADEGD
2e37E           ----------------------------------EVVLVDLDRKLAHAEDILHATPFAHPVWVRAGSYGA
3d3wA           ----------------------------------------------------------------------
1cg1A           -----------------------------------IGTTGRGIGPAYEDKVARRGLRVAEKLKEVMEYHN
2e37C           -----------------------------------LVDLDRKLAQAHAEDILHATPFAHPVWVRAGSYGA
3ctmH           ----------------------------------------------------------------------
1bhsA           ----------------------------------------------------------------------
3dxfB           ----------------------------------------------------------------------
3d3eB           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
3d5qD           ----------------------------------------------------------------------
3ce6D           ----------------------------------------------------------------------
3csdB           ------------------------------------------RGEEGLRTTLKELREAGVEADGRTCDVR
2e6hC           ----------------------------------RILVTNDDGIYSPGLWALAEAASEVFVAAPDGHA--
2e6cD           ----------------------------------RILVTNDDGIYSPGLWALAEAASEVFVAAPDT----
2d1yD           ----------------------------------LVALCDLRP----EGKEVAEAIGGAFFQVDLEDERE
3ek2D           ----------------------------------------------------------------------
3edmB           ------------------------------------------------AEIEKLGRSALAIKADLTN---
2aw5B           ----------------------------------------------------------------------
3e48A           ----------------------------------DHFHIGVRNVEK---VPDDWRGKVSVRQLD---YFN
1edoA           ----------------------------------------------------------------------
3c6cA           ----------------------------------------------------------------------
2ag5B           ----------------------------------KVIATDINESK---LQELEKYPGIQTRVLDVTKKKQ
3e03B           -----------------------------------------------TIHSAAAAVNAAGLKCDIREE--
2eggA           ----------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
2b35A           ----------------------------------QLVLTGFDRLRRITDRLPAKAPLLELDVQNEEHLA-
3byzA           ----------------------------------------------------------------------
2e37A           --------------------------------------------------------------------GA
3edmA           ------------------------------------------------AEIEKLGRSALAIKADLTN---
3ch6B           ----------------------------------------------------------------------
1c3vA           ----------------------------------------------------------------------
2e6gB           ----------------------------------RILVTNDDGIYSPGLWALAEAASQFGEVFVAA---P
2e6gK           ----------------------------------RILVTNDDG---------IYSPGLWALAEAASQFGE
3d64A           -----------------------------------------------EGYRVVTMEYAADKADIFVTAT-
2belB           ----------------------------------------------------------------------
2ekpA           ----------------------------------------------------------------------
3dooA           ----------------------------------------------------------------------
3d5qB           ----------------------------------------------------------------------
3bmeC           ----------------------------------RVVIHYHNSAESLADELNKERSNTAVVQADLTNS--
3c2qA           ----------------------------------ALYGTSLGVNIKTAKPVTGGHKHHIYAINAINDA--
1b3rA           ----------------------------------------------------------------------
3donA           ----------------------------------------------------------------------
3dfzA           ----------------------------------------------------------------------
3d4nB           ----------------------------------------------------------------------
3e03C           ----------------------------------------------------AGGQGLALKC-DIREE--
3d4nD           ----------------------------------------------------------------------
1c9kB           ------------------------------------------------DDEMAARIQHHKDGRPAHWRTA
3c2qB           ----------------------------------ALYGTSLGVNIKTAKPVTGGHKHHIYAINAINDA--
1d4fA           ----------------------------------------------------------------------
1dhrA           ----------------------------------------------------------------------
2e6gA           ----------------------------------RILVTNDDGIYSPGLWALAEAASQFGE-VFVAAPDA
2c20A           ----------------------------------------------------------------------
1di7A           ----------------------------------VSISDRYQGIPALEEWLTSALTTPFELETRLI--PD
1a7aA           ----------------------------------------------------------------------
2e37B           ----------------------------------------------------------------------
1dfiA           ----------------------------------GAELAFTYQNDKLKGRVAAQLGSDIVLQCDVAEDA-
2b37C           ----------------------------------------------------------------------
2aqkA           ----------------------------------------------------------------------
2aw5C           ----------------------------------------------------------------------
1cg3A           ----------------------------------------------------------------------
3ch6A           ----------------------------------------------------------------------
1adeA           ----------------------------------------------------------------------
2b4qB           ----------------------------------RVFICARDAEAADTATRLSAYGDCQAIPADLSSEAG
2e6eD           ----------------------------------RILVTNDDGIYSPGLWALAQFGEVFVAAPDIAHPVR
1a7aB           ----------------------------------------------------------------------
3bzuA           ----------------------------------------------------------------------
1ae1B           ----------------------------------------------------------------------
2aqhA           ----------------------------------------------------------------------
1cbuC           ----------------------------------------------------------------------
1ek5A           ----------------------------------------------------------------------
1a9yA           ----------------------------------------------------------------------
3e6vA           ------------------------------------------VDAHTDINTPLTTTSGNLHGQPVSF---
3cq0B           ----------------------------------DHEKIENAMDKILVEFGTQILKVVPGRVSTEVDARL
2e6gJ           ----------------------------------------------------------------------
1c9yA           ----------------------------------------------------------------------
3dtdB           ------------------------------------------------CGIQEGKKVCFMHRQEVNDQNR
3bzuD           ----------------------------------------------------------------------
3e9nB           ----------------------------------------------------------------------
1d7oA           ----------------------------------------------------------------------
3e9qA           ------------------------------------------------NEETGRQPQWFILDLLTCTS--
2e6hB           ----------------------------------RILVTNDDGIYSPGLWALA---------EAASQFG-
3edmD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNLVTPMTMTGAFIEHTVRFDCP
3dwfA           MTFAEEFVAEAGNLMGGLDMLILNHVLYNR-LTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGS
3dwfC           MTFAEEFVAEAGNLMGGLDMLILNHVLYNR-LTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGS
3deyX           --------------------LVCNAGL-GLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSG
1a27A           -----KSVAAARERVTEGRVDVLCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKR-RGS
3ch6E           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN--
3d5qC           -TFAEQFVAQAGKLMGGLDMLILNHITNTS-LNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ--SN
3d3eA           -TFAEQFVAQAGKLMGGLDMLILNHITN-TSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ--SN
1dj2A           ---TPEMLREEVEAYKRYAPYITDTVHFIN----DSISQKKKV--LVEGGQATMLDIDFGTYPFVTSSSP
2ae1A           -SERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERG
2e6hD           VFVAAPDTAGHAITIAHPVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLG
1a9zA           -----MTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYG
1dohB           VVEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEI--GG
2d1yB           -----VRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREM-RKVGG
1b8pA           LLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANA-QIFTVQGKAIDAVASRNIKVLVVGNP
2belC           DMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNG-
3czrA           AEQFVA---QAGKLMGGLDMLILNHITN-TSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ--SN
2b35E           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNP
3ce6B           -----KDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEG
2belA           ---FAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS
2e6bD           ----IAHPVRAYPHPSPLHAPHFPAYRV----------RGTPADCVALGLHLFGPVDLVLSGVNLGSNLG
3bmoB           NSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQN
2ehdA           ---DWARAVAAMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGG
3bhmA           --------------------------------------------TMKTNFFGTRDVCTELLPL---IKPQ
3bzuB           -TFAEQFVAQAGKLMGGLDMLILNHITN-TSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS
2ag5A           -----KQIDQFANEVERLDVLFNVAGFVHHG-TVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSG
1bmdA           LLAGLEATDDPDVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPA
2belD           --------------------------------------------SMEVNFLSYVVLTVAALPM--LKQSN
3edmC           AAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAI
3ce6A           ---GNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEG
2ag5C           -----KQIDQFANEVER-LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSG
2ehdB           -----------------------NAGV-GVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPA-LLRRGG
1cg4A           ---DTMAVADILTSMVVDVSDLLDQARQR--------GDFVMFEGAQGTLLDIDHGTYPYVT---SSNT-
2e37D           --------------------LDRNAQVFAQVVPRVAPEAVLLVATNPVDVTQVAYRLSGLPPGRVV--GS
3d4nC           ----------------------------------------------------------------------
1d4gA           ---GCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGRRIILLAEGR
1di6A           EQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVT-------PDATLAVADREMPGFGEQMRQISLHFVP
2e6bC           AHPV-----RAYPHPSPLHAPHFPAYRVRGTPADCVALGLHL----------FGPVDLVLSGVNLGSNLG
2cnbB           -VRNEDFLNGVFTRHGPIDAVVHMCAFL-AVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSA
2e6cC           -----AAGHAITIAHPVRA--YPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLG
3dwfB           -------------------------------LTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPM--LMQSQ
2cfcA           VNAAIAATMEQFGAIDVLVNNAGITGNS-EAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPH-MLLQGA
2e37E           RAVVLAAGVAQRPGETRLQLLDRNAQVFAQVVPRVLEAAPEAVLLVATNPVDVTQVAYRLSGLPPRVVGS
3d3wA           ------------------VDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARG-LIARGV
1cg1A           FQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT
2e37C           RAVVLAAGVAQRPGETRLQLLDRNAQVFAQVVPRVLEAAPEAVLLVATNPVDVTQVAYRLSGLPPGRVVG
3ctmH           ----------------------------------------------------------------------
1bhsA           ------------------------------LGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSG
3dxfB           -----------------------DLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVEEYFRDIGV
3d3eB           ----------------------------------------------------------------------
2cnbC           -VRNEDFLNGVFTRHGPIDAVVHMCAFLAV-GESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSA
3d5qD           ---FAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML--KQSN
3ce6D           -------IIMLEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEG
3csdB           SVPEIEALVAAVVERYGPVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERG
2e6hC           -----ITIAHPVRAYPHPSPLHAPHFPA-YRVRGTPADCVALGLHLFGPV------DLVLSGVNLGSNLG
2e6cD           HAITIAHPVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVD----------LVLSGVNLGSNLG
2d1yD           RVRFV----EEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREM-RKVGG
3ek2D           -------FASLKTHWDSLDGLVHSIGFAPEAIAGDFLDGLTRENFRIAHDISAYSFPALAKAALPMLSDD
3edmB           AAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAI
2aw5B           -----------------------AIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGR
3e48A           QESVEAFKGDTVVFIPSIIHPSFKRIPEVE-NLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFGYASRL
1edoA           ----------------------------------------------------------------------
3c6cA           ----------------------------------------------------------------------
2ag5B           IDQFANEV--------ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSG
3e03B           -DQVRAAVAATVDTFGGIDILVNNASAIWLRGTLDTPKRFD---LQQVNARGSFVCAQACLPHLLQAPNP
2eggA           ---------------------------VGMHPRVEVQPLSLERLRPGVIVSDIIYNPLETKWLKEAKARG
1c9kA           -----------------------------------------------------AIDDEIQILIAACQRCP
2b35A           ---SLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMN
3byzA           ----------------------------------------------------------------------
2e37A           RAVVLAAGVAQRPGETRLQLLDRNAQVFAQVVPRVLEAAPEAVLLVATNPVDVTQVAYRLSGLPPGRVGS
3edmA           AAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAI
3ch6B           ---------AQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS
1c3vA           -----------------------GTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAAR
2e6gB           IAHPVRAYPHPSPLHAPHFPAYRVRGTPAD-CVALGL---HLFGPVDLVLSGVNLGS----------NLG
2e6gK           ----VFVAAPDTITIAHPVRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEI
3d64A           ------GNYHVINHDHMKAMRHNAIVCNIGHFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEG
2belB           ----------------------------------------------------------------------
2ekpA           ---------KRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWG
3dooA           ----------------------------------------------------------------------
3d5qB           ------------------------------------------------------------------KQSN
3bmeC           -NVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQ--RQ
3c2qA           -----GNIKNAVESGVLKEGIYQCIKNNIPYVLAGSIRDDGPIPDVITDSVAQDKRTTVDKKVILS----
1b3rA           --------------------------------------------KVNIKPQVDRYLLKNGHRII--LLAE
3donA           ------------------------------------------------VSDIVYNPYKTPILIEAEQRGN
3dfzA           -----------------------------QIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYT
3d4nB           ------------------------------------------------------------------KQSN
3e03C           -DQVRAAVAATVDTFGGIDILVNNASAIWLRGTLDTPKRFD---LQQVNARGSFVCAQACLPHLLQAPNP
3d4nD           ----------------------------------------------------------------------
1c9kB           ECWRHLDTLITADLAPDDAILLECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPA
3c2qB           -GNIKNAVESGVLKEGIYQCIKNNIP----YVLAGSIRDDGPIPDVITDSVAQDKRTTVDKKVILSTLLH
1d4fA           ----------------------------------------------------------------------
1dhrA           --------------------------------------------MWKQSIWTSTISSHLATKHLKEGGL-
2e6gA           HP----VRAYPHPSPAPHFPAYRVRGTPAD-CVALGL---HLFGPVDLVL------SGVNLGS----NLG
2c20A           -----------------------------------------------------MDEFKVDKFIFSSTAAT
1di7A           EQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQ
1a7aA           -----------------------------------------------------IILLAEGRLVNLGCAGH
2e37B           --------------------LDRNAQVFAQVVPRVLEAAPEAVLLVATNPVDVTQVAYRLSGLPPGRVVG
1dfiA           ---SIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLN
2b37C           -----------------------------------------------------AYSYASMAKALLPIMNP
2aqkA           --------------------------------------------DVSKGIHISAYSYASMAKALLPIMNP
2aw5C           -----MKNLEAIVQEIKPTALIGVAAIAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGR
1cg3A           ----------------------------------------------------------------------
3ch6A           ----------------------------------------------------------------------
1adeA           -------------------------------------------FVMFEGAQGTLLDIDHGTYPYVTSSNT
2b4qB           --------ARRLAQALGELSARLDILVNNAGTSPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAENPA
2e6eD           AYPHPPHFPAYRVRGTPADCVALGLHLFGP-VDLVLSGVNLVAAAKQGYLFGLSAAAFSVPEVLLRLERP
1a7aB           -------------------------------------------RYRLKNGRRIILLAEGRLVNLGCAGH-
3bzuA           ------------------------------------------------------------------KQSN
1ae1B           ----------------------------------------------------------------------
2aqhA           ----------------------------------------------------------------------
1cbuC           ----------------------------------------------------AIDDEIQILIAACQRCPA
1ek5A           -------------------------------------------------LEIMKAHGVKNLVFSSSATVY
1a9yA           ----------------------------------------------------------------------
3e6vA           ----LLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVNPILKTLGIKYFSMTEVDRLGIGKVMEETLS
3cq0B           SFDKKATVKKALHIIKLYKDAGVPKERVLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEA
2e6gJ           -------------------------------------------------------------------NLG
1c9yA           -----LLLTNDPLEAAHGGNVLITDTWISMGREEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKP
3dtdB           VVVAMSVVLNADGVVSGNLTVPVSKPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAA--LRAGK
3bzuD           ------------------------------------------------------------------KQSN
3e9nB           ----------------------------------------------------------------------
1d7oA           ----------------------------------------------------------------------
3e9qA           -----ENCQQLAQRIVVNYPRLDGVLHNAGLLGDVCPSEQNPQVWQDVQINVNATFLTQALLPLLLKSDA
2e6hB           --EVFVAAPDHAITIAHPVRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHE-
3edmD           -----AAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAI


                         +         .         .         .         .         *         .:210
query           RKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTEYASVPEPRTLRAVALAPGVVDTGMQETIRGAD
3dwfA           IAV--VSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFL--VNKVNVSITLCILGLIDTETAIKATSGI
3dwfC           IAV--VSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFL--VNKVNVSITLCILGLIDTETAIKATSGI
3deyX           R-VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLL----PFGVHLSLIECGPVHTGSEEVLDRTD
1a27A           GRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLL----PFGVHLSLIECGPVHTAFMEKVLGSP
3ch6E           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNV--SITLCVLGLIDTETAMKAVSGI
3d5qC           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVQAA
3d3eA           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEY--SVSRVNVSITLCVLGLIDTETAMKAVSGI
1dj2A           S-AGGICTGLGIAPSVVGDLIGVVKAYTTRVGSGPFPTENLGTGGDLLRLAGQEFGTTTGRPRRCGWLDI
2ae1A           N-VVFISSVSGALAVPYEAVYGATKGAMDQLTRC----LAFEWAKDNIRVNGVGP-----GVIATQDPEQ
2e6hD           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLGEVPDFTLLRLERPFLVNVNLPLRPKGFLWTRQSVRAYEVI
1a9zA           DNPK-IPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQP----DWSIALLRYFNPVGAHPSGDMGE-DP
1dohB           RLILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDM----ADKKITVNVVAPGGIKTDM--------
2d1yB           GAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLA----PLRIRVNAVAPGAIATEAVLEAIRTR
1b8pA           ANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKT-------------------------------
2belC           -SIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGM
3czrA           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVS--
2b35E           GGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREA----GKYGVRSNLVAAGPIRTAGAQIQLLEE
3ce6B           R-LLNLGNATGHPQIELWTKNDEYDNEVYRLPKHLDEKVA----RIHVEALGGHLTKLTKEQAEYLG---
2belA           IVVVSSL--AGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTET--------
2e6bD           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLLERPFLVNVNLPLRPKGFLWTRQSVRAYEGV
3bmoB           LSIVNLCDAMVDQP-MAFSLYNMGKHALVGLTQSAALEL----APYGIRVNGVAPGVSLLPVAMGEEEKD
2ehdA           TIV-NVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLR----EANVRVVNVLPGLKPEDVAQAVLFAL
3bhmA           GRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLM----NKFVEDTKKGVHQKEGWPSSAYGVTK
3bzuB           IVV--VSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGI
2ag5A           NIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFI----QQGIRCNCVCPGTVDTPSLQERIQAR
1bmdA           N-TNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTG----TGVDRIRRMTVWGNHSST------MF
2belD           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETVSGIVHMQ
3edmC           VTF--SSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVG------------------------------
3ce6A           R-LLNLGNATGHPSFVMWTKNDEYDNEVYRLPKHLDEKVA--------RIHVEALGGHLTKLTKEQ--AE
2ag5C           NIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFI----QQGIRCNCVCPGTVDTPSLQERIQAR
2ehdB           GTIVNVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLR----EANVRVVNVLPGSVKLKPED------
1cg4A           -TAGGVATGSGLGPRYVDYVLGILKAYSTRFPTELFDETGE-----FLCKQGNEFGATTGLRRRT-GWLD
2e37D           GTILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVW----SSAQVGGVPLLEFAEARALSPEDRAR
3d4nC           -----VSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGI
1d4gA           LVNLGSFTNQVMAQIELWTHPDKYPVGVHFLPKKL--------DEAVAEAHLGKLNVKLTKLTEKQAQYL
1di6A           TAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGN----VVVHGIFASVPYCIQLLEGPYVETAP
2e6bC           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLLERPFLVNVNLPLRPKGFLWTRQSV------
2cnbB           A-IFGNPTAEPIDINAKKSPESPYGESKLIAERMIRDCA-------------------------------
2e6cC           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLLERPFLVNVNLPLRPKGFLWTRQSVRAYEGV
3dwfB           GSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFL--VNKVNVSITLCILGLIDTETAIKATSPK
2cfcA           GVIVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYA----GSGIRCNAVCPGMIETPMTQWR-LDQ
2e37E           GTILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVW----SSAQVGGVPLLEFAESPE--------
3d3wA           PGAIVNVSSQSQRAVTNHSVYCSTKGALDMLTK----VMALELGPHKIRVNAVNPTVVMTSMGQATW-SD
1cg1A           SSAGGVATGSGLGPRYVDYVLGILKAYSTRV---------------------------------------
2e37C           SGTI-LDTARFRALLAEYHAYVLGEHGDSEVLVW----SSAQVGGVPLLEFAEARGRALSPEDRARIDEG
3ctmH           SLIITSSISGKIVNIPQLQAPYNTAKAACTHLAKSLAIEW----APFARVNTISPGYIDTDI---TDFAS
1bhsA           R-VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLL----PFGVHLSLIECGPVHTAFMEKVLGSP
3dxfB           P-MTSVRLPCYFENLLSHFLPQKAPDGKSYLLSLPTGDVP----MDGMSVSDLGPVVLSLLKMP------
3d3eB           -----VSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGI
2cnbC           A-IFGNPTAEPIDINAKKSPESPYGESKLIAERMIRDCA----EAYGIKGICLRYFNACGAH--------
3d5qD           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSMQ
3ce6D           RLLN-LGNATGHPSFVMSNSFANQTIAQIELWTKNDYDNEVYRLPKHLRIHVEALGGHLTKLTKEQAEYL
3csdB           TGRVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELA----RTGITVNAVCPGFVETPMAASVREHT
2e6hC           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGLRTLET-LLRLERPFLVNLPLRPKGFLWTRQSVRAYEVI
2e6cD           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLLRLERPFLVNLPLRPKGFLWTRQSVRAYEVI
2d1yD           GAIVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLA----PLRIRVNAVAPGAIATEAVLEAIATR
3ek2D           ASLLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLG----AKGVRVNAISAGPIKSFGKILDFVES
3edmB           VTF--SSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVG------------------------------
2aw5B           AIF-ASGSPFDPVTLPNGQTLYPGQGNNSYVFP-----------GVALGVVACGLRQITDNIFLTTAEVI
3e48A           LST-SGIDYTYVRAYDPLKPYLPELNHKLIYPAGDGRINY------------------------------
1edoA           -RIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGA----SRNINVNVVCPGFIASDMTAKLGEDM
3c6cA           -----LIEEGLIDGVPLFQVLGVLWGAPASTETIYQRNLI----PANAQWAAFGIGRDQPAQAALLGGNV
2ag5B           NIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFI----QQGIRCNCVCPGTVDTPSLQERIQAR
3e03B           HILT-LAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFG----PQGVAINALWPRTVIATDAINLPGVD
2eggA           ARVQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALR------------------------------
1c9kA           AKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQ----RLA----AAADEVWLVVSGIGVK----------
2b35A           PGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFV----AREAGKYGVRSNLVAAGPIRTGAQI------
3byzA           -----VSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGK
2e37A           GTILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARALSPE--------
3edmA           V--TFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVG-----PKIRVNAVCPGMISTREGSSEDVAG
3ch6B           IVV--VSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAQAAP
1c3vA           FFDS-AEVIELHHPHKADAPSGTAARTAKLIAEARKGLPP----NPDATSTSLPGARGADAHQEVLFGTE
2e6gB           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLNG---------------------------------------
2e6gK           W---HSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLLERPFLVNVNLPLRPKGFLWTRQSVRAYEGV
3d64A           RLVNLGCSNSFTNQTLAQIELFTRGGEYANKVYVLPKHLD----EKVARLHLARIGAQLSELSD--DQAA
2belB           -------SLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGI
2ekpA           RLFIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWA----RLGIRVNLLCPGYVETEFTLPLR-QN
3dooA           -PIYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLK------------------------------
3d5qB           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGK
3bmeC           NLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQS------------------------------------
3c2qA           ---------TLLHSVATGNLPSYIKTVCVDIQPSTVTKLD----RGTSQAIGVVTDVGV-----------
1b3rA           GRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFEAVAEAHLGKLNVKLTKLTEKQAQYL
3donA           PIYN-GLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLKG-----------------------------
3dfzA           Q-YTQFLYECRVLIHRLNVSKSRKHELLTEIIDD---QYRLSLVKQREFLQQIEK---------------
3d4nB           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGI
3e03C           HILT-LAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFG----PQGVAINALWPRTVIATDAINLPGVD
3d4nD           -----VSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGI
1c9kB           KVVL-VTNEVGMGIVPENRLARHFRDIAGRVNQ----RLA----AAADEVWLVVSGIGVK----------
3c2qB           -------------SVATGNLPSYIKTVCVDIQPSTVTKLD----RGTSQAIGVVTDVGV-----------
1d4fA           -----LGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHDEAVAEAHLGKLNVKLTKLTEKQAQYL
1dhrA           --LTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKN--SGMPSGAAAIAVLPVTLDTPMNRKSMPEA
2e6gA           HEIWHSGTVAAAKQGYLFGLSAAAFSVPGEVPDFAGLRPWLLRTLETLNLPLRPKGFLWTRQSVRAYEGV
2c20A           YGEVDVDLITEETMTNPTNTYGETKLAIEKMLHWYSQASN-------LRYKIFRYFNVAGATPNGIIGED
1di7A           VVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVP----YCIQLLEGPYVETEVVAAFRP--
1a7aA           PSFVSNSFTNQVAQIELWTHPDKYPVGVHFLPKKLDEAVAEA--------HLGKLNVKLTKLTE------
2e37B           SGTI-LDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVL------------------------------
1dfiA           PGLLTLSYLGAERAIPNYNVMGLAKASLEANVRY----MANAMGPEGVRVNAISAGPIRTLM--------
2b37C           GGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG----KYGVRSNLVAAGPIRTGALGEEAGAQ
2aqkA           GGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG----KYGVRSNLVAAGPIRTLAMSAIVGGA
2aw5C           AIFA-SGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLAQQVSDKHLEEGRLYPPLNTIRDVSL
1cg3A           -----VATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELF--DETGEFLCKQGNEFATTGRRRRTGWLD
3ch6A           -----VSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETVHMQAAPK
1adeA           TAGG-VATGSGLGPRYVDYVLGILKAYSTRV---------------------------------------
2b4qB           RVINIGSVAGISAMGEQAYAYGPSKAALHQLSRML----AKELVGEHINVNVIAPGRFPSRMTR------
2e6eD           -FLVNV------NLPLRPKGFLWTRQSVRAYEGVVIPGED----PMGRPFYWFAPRPLKEAEEGT-----
1a7aB           PSFVSNSFTNQVAQIELWTHPDKYPVGVHFLPKKLDEAVA--------EAHLGKLNVKLTKLTEKQA---
3bzuA           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGK
1ae1B           -----LSSIAGFSALPSVSLYSASKGAINQMTKSLACEWA----KDNIRVNSVAPGVILTPLVETAIKKN
2aqhA           -----GMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG----KYGVRSNLVAAGPIRTLAMSAIVGGA
1cbuC           KVVL-VTNEVGMGIVP----ENRLARHFRDIAGRVNQRLA----AAADEVWLVVSGIG------------
1ek5A           GNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADK----TWNAVLLRYFNPTGAHASGC-IGEDP
1a9yA           -------------TGTPQSPFGKSKLMVEQILTDLQKAQP----DWSIALLRYFNPVGAHPSGDMGE-DP
3e6vA           YPIHLSFDVDGLDPTGTPVVGGLTYREGLYITEEIYKTGL----LSGLDIMEVNPSLGKTPE--------
3cq0B           N-VTLISPFVGRIMDFYKAYTAETDPGVLSV-----KKIYSYYKRHGYATEVMAASFRNLDELKALAG--
2e6gJ           HEIWHSGTVAAAKQGYLFGLSAAAFSVPLNGLRTLETLLLERPFLVNVNLPLRPKGFLWTRQSVRAYEGV
1c9yA           EEVDDEV-----FYSPRSLVFPEAENRKWTIMAVMVSLLT------------------------------
3dtdB           HLKLAMTIAAP-----GEPPLNDLFVQLNGFSNALNRLIAL-----------------------------
3bzuD           GSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYS--VSRVNVSITLCVLGLIDTETAMKAVSGK
3e9nB           -----------------NTIYAASKHALRGLADAFRKEEA----NNGIRVSTVSPIEPKEIANAIRFVID
1d7oA           --ISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAG---RKQNIRVNTISAGPLGSRAAKAIGFID
3e9qA           GSLVFTSSSVGRQGRANWGAYAASKFATEGQVLADEYQQ-------RLRVNCINPGGTRTARAS------
2e6hB           --IWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLLERPFLVNVNLPLRPKGFLWTRQSVRAYEGV
3edmD           VTF--SSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVG------------------------------


                         .         .         .         +         .         .         .:280
query           FAQVQRFRDLKDNEQLASPDDTARRIVAYLARPDFGTTELDDIRxx
3dwfA           YLG-----------PASPKEECALEII-------------------
3dwfC           YLG-----------PASPKEECALEII-------------------
3deyX           IHTFHRFYQYLAREAAQNPEEVAEVFLTALRAP-------------
1a27A           EEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPE------------
3ch6E           EECALEIIKGGALRQEEVYYDSS-RWTTLLIRNP------------
3d5qC           PKE-ECALEIIKGGALRQEEVYYDLWTTLLIRNP------------
3d3eA           VLEIIKGGALRQEEVYY----DSSLWTTLLIRNPSR----------
1dj2A           VALGFASLNLTKLDVLSDLNEIQ-LGVAYKRSDG------------
2ae1A           KENLNKLIDRCALRRMGEPKELA-AMVAFLCFPA------------
2e6hD           PGEDPMGRPFYWFAPRPLKEAEE-GTDRWAVAQGFVS---------
1a9zA           QGIPNNLMPYIAQVAVGRRDS-------------------------
1dohB           ----------------------------------------------
2d1yB           RDWEDLHALRRL----GKPEEVA-EAVLFLASEK------------
1b8pA           ----------------------------------------------
2belC           QAPKEECALEIIKGGALRQEEVY-YDSSLWTTLL------------
3czrA           ----------GVHMQAAPKEECALEIIK------------------
2b35E           GWDQRAPIGWNMK----DATPVA-KTVCALLSDW------------
3ce6B           ----------------------------------------------
2belA           ---AMKAVSGIVHMQAAPKEECALEIIK------------------
2e6bD           VIPGEDPMG-------------------------------------
3bmoB           ----------------------------------------------
2ehdA           EMPGHAMVS-------------------------------------
3bhmA           IG--------------------------------------------
3bzuB           VHMALEIIKGGALRQEEVYYDSS-LWTTLLIRNP------------
2ag5A           GNPEEARNDFLKRQKTGRFATAEEMLCVYLASDE------------
1bmdA           PDLFHAEVDGRPALELVDMEWYEKVFI-------------------
2belD           AAPKEECALEIIKGGALRQEEVYYDSTTLLIRNP------------
3edmC           ----------------------------------------------
3ce6A           YLGVDVEGPYK-----------------------------------
2ag5C           ----------------------------------------------
2ehdB           --VAQAVLFALEMPGHAMVSEIELR---------------------
1cg4A           TVAVRRAVQLNSLSGFC-----------------------------
2e37D           IDEGVRRAAYRIIEGKGATYYGIGAGLARLVRAILTD---------
3d4nC           MQAAPKEECALEIGGALRQEEVYYDSTTLLIRNP------------
1d4gA           GMPING---------PFKPDH-----YRY-----------------
1di6A           ----------------------------------------------
2e6bC           ----------------------------------------------
2cnbB           ----------------------------------------------
2e6cC           VGEDPMGRPFYWFAPRPLKEAEEGTDRWAVA---------------
3dwfB           EECALEIIKGTALRQDEMYYVGS-RWVPYLLGNP------------
2cfcA           PELRDQVLARIPQKEIGTAAQVA-DAVMFLAGED------------
2e37E           ----------------------------------------------
3d3wA           PHKAKTMLNRIPLGKFAEVEHVV-NAILFLLSDR------------
1cg1A           ----------------------------------------------
2e37C           VRRAAYRIIEGKGATYYGIGAGLARLVRAILTDEKG----------
3ctmH           KDMKAKWWQLTPLGREGLTQELV-GGYLYLASNA------------
1bhsA           FYQYLAHSKQVFREAAQNPEEVAEVFLTALRAP-------------
3dxfB           ----------------------------------------------
3d3eB           VAPKEECALEIIKGGALRQEEVYYDSTTLLIRNP------------
2cnbC           ----------------------------------------------
3d5qD           AAPKEECALEIIKGGALRQEEVYYDSTTLLIRNPSR----------
3ce6D           GVDVEPYK--------------------------------------
3csdB           EEAFDRITARVPIGRYVQPSEVA-EMVAYLIGPG------------
2e6hC           PGEDPMGRPFYWFAPRPLKEAEEGTDRWAVA---------------
2e6cD           PGEDPMGRPFYWFAPRPLKEAEEGTDRWAVA---------------
2d1yD           RDWEDLHALRRL----GKPEEVAEAVLFLASEKASFIT--------
3ek2D           NSPLKRNVT---------IEQVGNAGAFLLSDLASGVT--------
3edmB           ----------------------------------------------
2aw5B           AQQVSDKHLEEGRTIRDVSLKIA-EKIVKDAYQE------------
3e48A           ----------------------------------------------
1edoA           EKKILGTIPLGRTGQ---PENVA-GLVEFLALSP------------
3c6cA           RVGLEDNLYLSRGVFATNGQLVER--ARTVIEHLGSVATPDEAR--
2ag5B           GN--------------------------------------------
3e03B           AAACRRPEIADAAHAVLTRE--------------------------
2eggA           ----------------------------------------------
1c9kA           ----------------------------------------------
2b35A           ----------------------------------------------
3byzA           EECALEIIKGGALRQEEVYYDSS-LWTTLLIRNP------------
2e37A           ----------------------------------------------
3edmA           LV--------------------------------------------
3ch6B           KEECALEIIKGGALRQEEVYYDSSRWTTLLIRNP------------
1c3vA           GETLTIRHDSLD--RTSFVPGVL-LAVRRIAERPGLT---------
2e6gB           ----------------------------------------------
2e6gK           VIPGEDPMGRPFYWFAPRPLKEA-EEGTDRW---------------
3d64A           YIGVSKAGPFK-----------------------------------
2belB           VHMALEIIKGGALRQEEVYYDSS-LWTTLLIRNP------------
2ekpA           PELYEPITARIPMGRWARPEEIA-RVAAVLCGDE------------
3dooA           ----------------------------------------------
3d5qB           EECALEIIKGGALRQEEVYYDSS-LWTTLLIRNP------------
3bmeC           ----------------------------------------------
3c2qA           ----------------------------------------------
1b3rA           GMPING---------PFKPDH-----YRY-----------------
3donA           ----------------------------------------------
3dfzA           ----------------------------------------------
3d4nB           VHMQAAPKEECALEIIKVYYDSS-LWTTLLIRNP------------
3e03C           AAACRRPEIADAAHAVLTRE--------------------------
3d4nD           HMQAAPKEECALEGGALRQEEVYSLWTTLLIRNP------------
1c9kB           ----------------------------------------------
3c2qB           ----------------------------------------------
1d4fA           GMPING---------PFKPDH-----YRY-----------------
1dhrA           DFSSWTP-----------LEFLV-ETFHDWITGN------------
2e6gA           V---------------------------------------------
2c20A           HRPETHLIPLVLQVALGQREK-------------------------
1di7A           ----------------------------------------------
1a7aA           ----------------------------------------------
2e37B           ----------------------------------------------
1dfiA           ----------------------------------------------
2b37C           IQLEGWDQRAPIGWNMKDATPVA-KTVCALLSDW------------
2aqkA           LGEEAGAQIQLLEEGMKDATP-VAKTVCALLSDW------------
2aw5C           KIAEKIVKDAYQEKTATVYPEPQ-NKEAFVRSQM------------
1cg3A           TVAVRRAVQLNSLSGFC-----------------------------
3ch6A           EECALEIIKGGALRQEEVYYDSS-RWTTLLIRNP------------
1adeA           ----------------------------------------------
2b4qB           ----------------------------------------------
2e6eD           ----------------------------------------------
1a7aB           ----------------------------------------------
3bzuA           EECALEIIKGGALRQEEVYYDSS-LWTTLLIRNP------------
1ae1B           PHEIDNFIVKTPMGRAGKPQEVS-ALIAFLCFPA------------
2aqhA           LGEEAGAQIQLLEEGWDQRAPIGWNMVCALLSDW------------
1cbuC           ----------------------------------------------
1ek5A           QGIPNNLMPYVSQVAIGRREALN-----------------------
1a9yA           QGIPNNLMPYIAQVAVGRRDSLA-IFGNDYPTEDG-----------
3e6vA           ----------------------------------------------
3cq0B           ----------------------------------------------
2e6gJ           V---------------------------------------------
1c9yA           ----------------------------------------------
3dtdB           ----------------------------------------------
3bzuD           EECALEIIKGGALRQEEVYYDSS-LWTTLLIRNPSR----------
3e9nB           AGETTQITNV------------------------------------
1d7oA           TMIEYSYNNAPIQKT-LTADEVG-NAAAFLVSPL------------
3e9qA           ----------------------------------------------
2e6hB           VIPGEDPMGRPFYWFAPRPLKEA-EEGTDRW---------------
3edmD           ----------------------------------------------