[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07996.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c5qA.bssp"
#ERROR : Can't open dsspfile "1d7kA.bssp"
#ERROR : Can't open dsspfile "1d7kB.bssp"
#ERROR : Can't open dsspfile "3e5pB.bssp"
#ERROR : Can't open dsspfile "3e5pA.bssp"
#ERROR : Can't open dsspfile "1bd0B.bssp"
#ERROR : Can't open dsspfile "3btnA.bssp"
#ERROR : Can't open dsspfile "3b8tA.bssp"
#ERROR : Can't open dsspfile "3b8vD.bssp"
#ERROR : Can't open dsspfile "3b8uB.bssp"
#ERROR : Can't open dsspfile "3b8vA.bssp"
#ERROR : Can't open dsspfile "3btnB.bssp"
#ERROR : Can't open dsspfile "3b8wA.bssp"
#ERROR : Can't open dsspfile "3b8uA.bssp"
#ERROR : Can't open dsspfile "3b8vC.bssp"
#ERROR : Can't open dsspfile "3b8wD.bssp"
#ERROR : Can't open dsspfile "3b8uC.bssp"
#ERROR : Can't open dsspfile "1bd0A.bssp"
#ERROR : Can't open dsspfile "2dy3A.bssp"
#ERROR : Can't open dsspfile "2dy3D.bssp"
#ERROR : Can't open dsspfile "3b8tD.bssp"
#ERROR : Can't open dsspfile "3cpgA.bssp"
#ERROR : Can't open dsspfile "3co8B.bssp"
#ERROR : Can't open dsspfile "3co8A.bssp"
#ERROR : Can't open dsspfile "2dy3B.bssp"
#ERROR : Can't open dsspfile "3b8uD.bssp"
#ERROR : Can't open dsspfile "3b8tC.bssp"
#ERROR : Can't open dsspfile "2dy3C.bssp"
#ERROR : Can't open dsspfile "3b8wC.bssp"
#ERROR : Can't open dsspfile "1b54A.bssp"
#ERROR : Can't open dsspfile "1ct5A.bssp"
#ERROR : Can't open dsspfile "3bq6A.bssp"
#ERROR : Can't open dsspfile "3bq5A.bssp"
#ERROR : Can't open dsspfile "3bq5B.bssp"
#ERROR : Can't open dsspfile "3bq6B.bssp"

## Summary of PDB Search
:397
    4e-49  28%  3c5qA  [x.x.x] DIAMINOPIMELATE DECARBOXYLASE
    1e-42  19%  1d7kA  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    2e-42  18%  1d7kB  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    9e-42  13%  3e5pB  [x.x.x] ALANINE RACEMASE
    3e-38  13%  3e5pA  [x.x.x] ALANINE RACEMASE
    2e-36  14%  1bd0B  [b.49.2 - c.1.6] ALANINE RACEMASE
    9e-34  19%  3btnA  [x.x.x] ANTIZYME INHIBITOR 1
    3e-33  14%  3b8tA  [x.x.x] ALANINE RACEMASE
    3e-33  14%  3b8vD  [x.x.x] ALANINE RACEMASE
    4e-33  14%  3b8uB  [x.x.x] ALANINE RACEMASE
    5e-33  14%  3b8vA  [x.x.x] ALANINE RACEMASE
    1e-32  21%  3btnB  [x.x.x] ANTIZYME INHIBITOR 1
    1e-32  14%  3b8wA  [x.x.x] ALANINE RACEMASE
    9e-32  13%  3b8uA  [x.x.x] ALANINE RACEMASE
    1e-31  15%  3b8vC  [x.x.x] ALANINE RACEMASE
    7e-31  13%  3b8wD  [x.x.x] ALANINE RACEMASE
    2e-30  14%  3b8uC  [x.x.x] ALANINE RACEMASE
    4e-30  14%  1bd0A  [b.49.2 - c.1.6] ALANINE RACEMASE
    2e-29  19%  2dy3A  [x.x.x] ALANINE RACEMASE
    4e-29  19%  2dy3D  [x.x.x] ALANINE RACEMASE
    4e-28  15%  3b8tD  [x.x.x] ALANINE RACEMASE
    6e-28  13%  3cpgA  [x.x.x] UNCHARACTERIZED PROTEIN
    9e-27  16%  3co8B  [x.x.x] ALANINE RACEMASE
    2e-26  18%  3co8A  [x.x.x] ALANINE RACEMASE
    5e-25  21%  2dy3B  [x.x.x] ALANINE RACEMASE
    4e-24  13%  3b8uD  [x.x.x] ALANINE RACEMASE
    8e-24  13%  3b8tC  [x.x.x] ALANINE RACEMASE
    1e-23  20%  2dy3C  [x.x.x] ALANINE RACEMASE
    7e-20  14%  3b8wC  [x.x.x] ALANINE RACEMASE
    1e-15  11%  1b54A  [x.x.x] YEAST HYPOTHETICAL PROTEIN
    4e-15  13%  1ct5A  [c.1.6] PROTEIN (YEAST HYPOTHETICAL PROTEIN, SELENOMET)
    1e-06  15%  3bq6A  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-06  15%  3bq5A  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-04  15%  3bq5B  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-04  15%  3bq6B  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEQCALYYAVKANSDAPVLRALLGVADGFE
3c5qA           -------------------------------------------SLICYALKANSNLSILSLLAHLESGAD
1d7kA           --------------------------------------------VTPFYAVCNDSKAIVKTLAATGTGFD
1d7kB           --------------------------------------------VTPFYAVCNDSKAIVKTLAATGTGFD
3e5pB           ----------------------------------------PEGTALFAVVKANGYGHGAVESAGGATGFC
3e5pA           ----------------------------------------PEGTALFAVVKANGYGHGAVESAGGATGFC
1bd0B           ----------------------------------------PDDTHIMAVVKANAYGHGDVQVARTASRLA
3btnA           ----------------------------------------VAQIKPFYTVKCNSTPAVLEILAALGTGFA
3b8tA           ----------------------------------------APASKMVAVVKANAYLLETARTLPDADAFG
3b8vD           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
3b8uB           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
3b8vA           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
3btnB           ----------------------------------------VAQIKPFYTVKCNSTPAVLEILAALGTGFA
3b8wA           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
3b8uA           ----------------------------------------APASKMVAVVKANAYGHGLLETARTLPDFG
3b8vC           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
3b8wD           ---------------------------------------------MVAVVKANAYGHGLLETARTLPDFG
3b8uC           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
1bd0A           ----------------------------------------PDDTHIMAVVKANAYGHGDVQVARTASRLA
2dy3A           ----------------------------------------AGPAKLMAVVKANAVEKVAPVIAAHADAFG
2dy3D           ----------------------------------------AGPAKLMAVVKANAVEKVAPVIAAHADAFG
3b8tD           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
3cpgA           ----------------------------------------DIGEIAAIDAGVRIGENRPQEVTAKAEGLA
3co8B           ----------------------------------------SGAKTLWLAVKSNALLQVSKIARECVDGLA
3co8A           ----------------------------------------SGAKTLWLAVKSNAYGHGLLQVSKIADGLA
2dy3B           ----------------------------------------AGPAKLMAVVKANAVEKVAPVIAAHADAFG
3b8uD           ---------------------------------------------MVAVVKANAYGHGLLETARTLPDAD
3b8tC           ---------------------------------------------MVAVVKANAYLLETARTLPDADAFG
2dy3C           ----------------------------------------AGPAKLMAVVKANAVEKVAPVIAAHADAFG
3b8wC           ---------------------------------------------MVAVVKANAYGHGLLETARTLPDFG
1b54A           --------------------------------------------------KLKPASDIQILYDHGVREFG
1ct5A           -------------------------------------------------------ASDIQILYDHVREFG
3bq6A           ---------------------------------------------VFTYYDSVSDYEACVSLPVKRLHFD
3bq5A           ---------------------------------------------VFTYYDSVSDYEACVSLPVKRLHFD
3bq5B           ---------------------------------------------VFTYYDSVSDYEACVSLPVKRLHFD
3bq6B           ---------------------------------------------VFTYYDSVSDYEACVSLPVKRLHFD


                         .         .         *         .         .         .         .:140
query           VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRA
3c5qA           CVSIGEIQRALGIKPYR-IVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRI
1d7kA           CASKTEIQLVQGVPPER-IIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDD
1d7kB           CASKTEIQLVQGVPPER-IIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDD
3e5pB           VALLDEAIELRGVQDPI-LILSVVDLAYVPL--LIQYDLSVTVATQEWLEAALQQLTPESNTPLRVHLKV
3e5pA           VALLDEAIELRGVQDPI-LILSVVDLAYVPL--LIQYDLSVTVATQEWLEAALQQLTPESNTPLRVHLKV
1bd0B           VAFLDEALALRGIEAPI-LVLGASRPADAALAAQQRIALTVFRSDWLEEASAL----YSGPFPIHFHLKM
3btnA           CSSKNEMALVQGVSPEN-IIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVL-------
3b8tA           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHF-HTAVHNEEQLAALEEASLDEPV---TVWML
3b8vD           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHF-HTAVHNEEQLAALEEASLDEPVTV------
3b8uB           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTA-VHNEEQLAALEEASLDEPV---TVWML
3b8vA           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHF-HTAVHNEEQLAALEEASLDEPVTV------
3btnB           CSSKNEMALVQGVSPEN-IIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPN----AKVLLH-
3b8wA           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTA-VHNEEQLAALEEASLDEPV---TVWML
3b8uA           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTA-VHNEEQLAALEEASLDEPV---TVWML
3b8vC           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHF-HTAVHNEEQLAALEEASLDEPV---TVWML
3b8wD           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHF-HTAVHNEEQLAALEEASLDEPV---TVWML
3b8uC           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTA-VHNEEQLAALEEASLDEPV---TVWML
1bd0A           VAFLDEALALRGIEAPI-LVLGASRPADAALAAQQRIALTVFRSDWLEEASAL----YSGPFPIHFHLKM
2dy3A           VATLAEAMQLRGISQEV-LCWIWTPEQDFRA--AIDRNIDLA-VIS---PAHAKALIETDAEHIRVSIKI
2dy3D           VATLAEAMQLRGISQEV-LCWIWTPEQDFRA--AIDRNID-LAVIS---PAHAKALIETDAEHIRVSIKI
3b8tD           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTA-VHNEEQLAALEEASLDEPV---TVWML
3cpgA           RRCAERGFSLGVAAAEHIFHLIGQLQSN-KIGKVLPVVDTIESVDSIDLAEKISRRAVARGITVGVLLEV
3co8B           VSVLDEGIAIRGIDDFI-LILGPIDVKYAPI--ASKYHFLTT-VSSLDWLKSADKILG--KEKLSVNLAV
3co8A           VSVLDEGIAIRGIDDFI-LILGPIDVKYAPIASKYHFL---TTVSSLDWLKSADKIL--GKEKLSVNLAV
2dy3B           VATLAEAMQLRGISQEV-LCWIWTPEQDFRA--AIDRNIDLA-VIS---PAHAKALIETDAEHIRVSIKI
3b8uD           AFGVARLEEALRLRAGGPVLLLEGFFDARDLPTISAQHF-HTAVHNEEQLAALEEALDEPV----TVWML
3b8tC           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTA-VHNEEQLAALEEASLDEPV---TVWML
2dy3C           VATLAEAMQLRGISQEV-LCWIWTPEQDFRAAIDRNIDLAVISPA------HAKALIETDAEHIRVSIKI
3b8wC           VARLEEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEE-QLAALEEASLDEPV---TVWML
1b54A           ENYVQELIEKALPDDIK-WHFIGGLQTNKCKDLAKVPNLYSVETIDSLKK------AKKLNESRAKFQPD
1ct5A           ENYVQELIEKALPDDIK-WHFIGGLQTNKCKDLAKVPNLYSVEIDSLKKAKKLNESFQPDCNPILCNVQI
3bq6A           FVSNEENNLEKHGFPEDKKLVAGVINGRQPWKVDLRKVASLVE-----KLGASAISNSCPLFHLPVTLEL
3bq5A           FVSNEEKNLEKHGFPEDKKLVAGVINGRQPWKVDLRKVASLVE-----KLGASAISNSCPLFHLPVTLEL
3bq5B           FVSNEENLEKHGFPED-KKLVAGVINGRQPWKVDLRKVASLVE-----KLGASAISNSCPLFHLPVTLEL
3bq6B           FVSNEEKNLEKHGFPEDKKLVAGVINGRQPWKVDLRKVASLVE-----KLGASAISNSCPLFHLPVTLEL


                         +         .         .         .         .         *         .:210
query           NPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA
3c5qA           NPNIDKTHPYLSTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHIGSQLLDLEPIIEASQKVAKIA
1d7kA           SKA---------VCRLSVKFGATLRTSRLLLERAKE-LNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
1d7kB           SKA---------VCRLSVKFGATLRTSRLLLERAK-ELNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
3e5pB           DT------------GMGRIGFLTPEETKQAVRFVQSHKEFLWEGIFTHFSTADEIDTSYF---EKQAGRF
3e5pA           DT------------GMGRIGFLTPEETKQAVRFVQSHKEFLWEGIFTHFSTADEIDTSYFEKQAGR--FK
1bd0B           DTGMG------------RLGVKDEEETKRIVALIERHPHFVLEGLYTHFATAD---EVNTDYFSYQYTRF
3btnA           ----------LHIATEDMKFGTTLKNCRHLLECAKE-LDVQIIGVKFHVSSACKEYQVYVHALSDARCVF
3b8tA           DT-------------GMHRLGVRPEQAEAFYHRLTQCKNRQPVNIVSHFARADEPKCGATE------KQL
3b8vD           ----------WMLDTGMHRLGVRPEQAEAFYHRLTQCKVRQPVNIVSHFARADEPKCGATE------KQL
3b8uB           DT-------------GMHRLGVRPEQAEAFYHRLTQCKNRQPVNIVSHFARADEPKCGATE------KQL
3b8vA           ----------WMLDTGMHRLGVRPEQAEAFYHRLTQCKNVQPVNIVSHFARADEPKCGATE------KQL
3btnB           ------------IATEDMKFGTTLKNCRHLLECAKE-LDVQIIGVKFHVSSACKEYQVYVHALSDARCVF
3b8wA           DT-------------GMHRLGVRPEQAEAFYHRLTQCNVRQPVNIVSHFARADEPKCGATE------KQL
3b8uA           DT-------------GMHRLGVRPEQAEAFYHRLTQCKNRQPVNIVSHFARADEPKCGATE------KQL
3b8vC           DT-------------GMHRLGVRPEQAEAFYHRLTQCKVRQPVNIVSHFARADEPKCGATE------KQL
3b8wD           DT-------------GMHRLGVRPEQAEAFYHRLTQCKNRQPVNIVSHFARADEPKCGATE------KQL
3b8uC           DT-------------GMHRLGVRPEQAEAFYHRLTQCKNRQPVNIVSHFARADEPKCGATE------KQL
1bd0A           DT------------GMGRLGVKDEEETKRIVALIERHPHFVLEGLYTHFATAD---EVNTDYFSYQYTRF
2dy3A           DS-------------GLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLAE----TDRQIIAFRRALALA
2dy3D           DS-------------GLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLACADEPTDRQIIAFRRALALA
3b8tD           DT-------------GMHRLGVRPEQAEAFYHRLTQCKNRQPVNIVSHFARADEPKCGATEKQLAIFNTF
3cpgA           N-----------ESGEESKSGCDPAHAIRIAQKIGTLDGIELQGLTIG--AHVHDETVIRRGFSHLRKTR
3co8B           DT------------GNRIGVRSKKDLKDEIEFLQEHSDHFSYDGIFTHFASDNPDDHYFQRQKNRWYELI
3co8A           DT------------GNRIGVRSKKDLKDEIEFLQEHSDHFSYDGIFTHFAF-QRQKNRWYELIDGLIPRY
2dy3B           DS-------------GLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLAC-APETDRQIIAFRRALALA
3b8uD           DTGM-------------HRLGVRPEQAEAFYHRLTQCKNRQPVNIVSHFARADEPKCGATE------KQL
3b8tC           DTGMHRLGVRPEQAEAF------------YHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNTF
2dy3C           DS-------------GLHRSGVDEQEWEGVFSALAAAPHIEVTGMFTHLACADEPPETDIIAFRRALALA
3b8wC           D-----------TGMHRLGVRPEQAEAFYHRLTQC-KNVRQPVNIVSHFA----RADEPKCGATEKQLAI
1b54A           CNPILC-NVQINTSHEDQKSGLNNEAEIFEVIDFFECKYIKLNGLMTIGSWENRD--------FATLVEW
1ct5A           N-----------TSHEDQKSGLNNEAEIFEVILSEECKYIKLNGLTIGSWNR--DFATLVEWKKKIDAKF
3bq6A           EN--------------------------------------------------------------------
3bq5A           EN--------------------------------------------------------------------
3bq5B           EN--------------------------------------------------------------------
3bq6B           ENNL------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVA
3c5qA           KSLIA-LGIDLRFFDVGGGIGVSYE-NEETIKLYDYAQGILNALQGLDL--TIICEPGRSIVAESGELIT
1d7kA           DMGAE-VGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAV
1d7kB           DMGAE-VGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAV
3e5pB           KAVLAVLEELPRYVHVSNSATALWH-PDVPGNMIRYGVAM------YGLNPSGNKLAPSYALKPALRLTS
3e5pA           AVLAVL-EELPRYVHVSNSATALWH-PDVPGNMIRYGVAM------YGLNPSGNKLAPSYALKPALRLTS
1bd0B           LHMLEWLPSRPPLVHCANSAASLRF-PDRTFNMVRFGIAMYGL-----APSPGIKPLLPYPLKEAFSLHS
3btnA           DMAGE-FGFTMNMLDIGGGFTGTEIQLEEVNHVISPLLDIYFPEG---SGIQIISEPGSYYVSSAFTLAV
3b8tA           AIFNTFCEGKPGQRSIAASGGILLW-PQSHFDWVRPGIILYGV-----SALEDRSTGADFGCQPVMSLTS
3b8vD           AIFNTFCEGKPGQRSIAASGGILLW-PQSHFDWVRPGIILYGV-----SPLKDRSTGADFGCQPVMSLTS
3b8uB           AIFNTFCEGKPGQRSIAASGGILL-WPQSHFDWVRPGIILYGV-----SPLADRSTGADFGCQPVMSLTS
3b8vA           AIFNTFCEGKPGQRSIAASGGILLW-PQSHFDWVRPGIILYGV-----SPLKDRSTGADFGCQPVMSLTS
3btnB           DMAGEF-GFTMNMLDIGGGFTG----TEIQLEEVNHVISPLLDIYPEGSGIQIISEPGSYYVSSAFTLAV
3b8wA           AIFNTFCEGKPGQRSIAASGGILL-WPQSHFDWVRPGIILYGV-----SPLPDRSTGADFGCQPVMSLTS
3b8uA           AIFNTFCEGKPGQRSIAASGGILLW-PQSHFDWVRPGIILYGV-----SPLADRSTGADFGCQPVMSLTS
3b8vC           AIFNTFCEGKPGQRSIAASGGILLW-PQSHFDWVRPGIILYGV-----SPLKDRSTGADFGCQPVMSLTS
3b8wD           AIFNTFCEGKPGQRSIAASGGILLW-PQSHFDWVRPGIILYGV-----SPLPDRSTGADFGCQPVMSLTS
3b8uC           AIFNTFCEGKPGQRSIAASGGILLW-PQSHFDWVRPGIILYGV-----SPLADRSTGADFGCQPVMSLTS
1bd0A           LHMLEWLPSRPPLVHCANS-AASLRFPDRTFNMVRFGIAMYGL-----APSPGIKPLLPYPLKEAFSLHS
2dy3A           RK----HGLECPVNHVCNSPAFLTR-SDLHMEMVRPGLAFYGLEPVAGL---------EHGLKPAMTWEA
2dy3D           RK----HGLECPVNHVCNSPAFLTR-SDLHMEMVRPGLAFYGLEPVAGL---------EHGLKPAMTWEA
3b8tD           CEG----KPGQRSIAASGGILLWP---QSHFDWVRPGIILYGVSASTGADFSLTSSLIAVREHKAGEPVG
3cpgA           DLILASGEPGTDRCRELSGTGDELA-IAEGSTIVRVGTAI------------------------------
3co8B           DGL----IPRYVHVNSGAAYHSKE--LPGCNSIARVGTVVYGV-----EPSEGVLGPIDKL-KPVFELKS
3co8A           VHVNSGHSKELPGCNSIARVGTVVYGVEPSEGVLGPIDKLKPVFEKSALTFVKKIPAGEGISYGSKFVTS
2dy3B           RKH----GLECPVNHVCNSPAFLTR-SDLHMEMVRP--GLAFYGLEPVAGLEHGLKPAMT-------WEA
3b8uD           AIFNTFCEGKPGQRSIAASGGILL-WPQSHFDWVRPGIILYGVDFGCQPVMSLTSSLIAVREHKAGEPVG
3b8tC           CEGKP------GQRSIAASGGILL-WPQSHFDWVRPGII-----LYGVSALEDRSTGADFGCQPVMSLTS
2dy3C           RK----HGLECPVNHVCNSPAFLTR-SDLHMEMVRP--GLAFYGLEPVAGLEHGLKP-------AMTWEA
3b8wC           FNTFCEGKPGQRSIAASGGILLWPQ---SHFDWVRPGIILYGVSPLPDR--STGADFGCQPVMSLTSSLI
1b54A           KKKIDAKFGTSLKLSMGMSADFRE-AIRQGTAEVRIGTDI------------------------------
1ct5A           GTSLKL------------SGSADFREIRQGTAEVRIGTDI------------------------------
3bq6A           ----------------------------------------------------------------------
3bq5A           ----------------------------------------------------------------------
3bq5B           ----------------------------------------------------------------------
3bq6B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVL
3c5qA           QVLYEKKN--KRFVIVDAGMNDFLRPSLYHAKHAIRVITPSEI-----------SPCDVVGPVCESSDTF
1d7kA           NIIAKKIVLKEQTEQTFMYYVNSFNCILYDHAHVKPLLQKRP------KPDERYYSSSIWGPTCDGLDRI
1d7kB           NIIAKKIVLKEQSSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDERYYSSSIWGPTCDGLDRI
3e5pB           ELIHVKRLAAGEGIGYGETYVTEAE--EWIGTVPIGYADGWLRHLQGFTVLVNGKRCEIVGRVCMDQCMI
3e5pA           ELIHVKRLAAGEGYVTEAEEWIGTVPIGYADGWLRHLQGFTVL--------VNGKRCEIVGRVCMDQCMI
1bd0B           RLVHVKKLQPGEKVSYGATYTAQTE--EWIGTIPIGYADGWLRRLQHFHVLVDGQKAPIVGRICMDQCMI
3btnA           NIIAKKVVAFVYYMNDGVYGSFAS---KLSTIPEV--------------HKKPLFTSSLWGPSCDELDQI
3b8tA           SLIAVREHKAGEPVGYGGTWVSER-DTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICV
3b8vD           SLIAVREHKAGEPVGYGGTWVSER-DTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICV
3b8uB           SLIAVREHKAGEPVGYGGTWVSERRLGVVAMGYGDGYPRAAPSGTP---VLVNGREVPIVGRVAMDMICV
3b8vA           SLIAVREHKAGEPVGYGGTWVSER-DTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICV
3btnB           NIIAKKVAFVYYMNDGVYGSFASKLTIP--------------------EVHKPLFTSSLWGPSCDELDQI
3b8wA           SLIAVREHKAGEPVGYGGTWVSER-DTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICV
3b8uA           SLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYG-DGYPRAAPSGTPVLVNGREVPIVGRVAMDMICV
3b8vC           SLIAVREHKAGEPVGYGGTWVSERVAMGYGDGYPRAAPSGTPVL-------VNGREVPIVGRVAMDMICV
3b8wD           SLIAVREHKAGEPVGYGGTWVSER-DTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICV
3b8uC           SLIAVREHKAGEPVGYGGTWVSER-DTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICV
1bd0A           RLVHVKKLQPGEKVS-YGATYTAQTEEWIGTIPIGYA-DGWLRRLQHFHVLVDGQKAPIVGRICMDQCMI
2dy3A           KVSVVKQIERGFVAVVPAGYADGMPRHAQGKFSVT----------------IDGLDYPQVGRVCMDQFVI
2dy3D           KVSVVKQIEQGFVAVVPAGYADG-MPRHAQGKFS---------------VTIDGLDYPQVGRVCMDQFVI
3b8tD           YGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTP----------------VLVNGREVPIVGRVAMDMICV
3cpgA           ----------------------------------------------------------------------
3co8B           ALTFVKKWIGTLPIGYGDGLAEYQDFQLLIDGQKCRQVGQIADQVALPHEYPIGTEVTLIGKSGKYENTL
3co8A           R--------DTWIGTLPIGYGDGWLAELLIDGQKCRQVGQIADQVALPHEYPIGTEVTLIGKSGKYEN--
2dy3B           KVSVVKQIR-GFVAVVPAGYADG-MPRHAQGKFSV---------------TIDGLDYPQVGRVCMDQFVI
3b8uD           YGGTWVSERDTRLGVVAMGYGDGYPRAA----------------PSGTPVLVNGREVPIVGRVAMDMICV
3b8tC           SLIAVREH--KAGEPVGYGGTWVS--ERDTRLGVVAMGYGDGYPRAAPSGTPVLVNVPIVGRVAMDMICV
2dy3C           KVSVVKQI-RGFVAVVPAGYADG-MPRHAQGKFSVT---------------IDGLDYPQVGRVCMDQFVI
3b8wC           AVREHKAGEPVGTWVSERDTRLGVVAMGYGDGYP-RAAPSGTPVVPIVGRVAM------DMICVDLGPQA
1b54A           ----------------------------------------------------------------------
1ct5A           ----------------------------------------------------------------------
3bq6A           ----------------------------------------------------------------------
3bq5A           ----------------------------------------------------------------------
3bq5B           ----------------------------------------------------------------------
3bq6B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGGQP
3c5qA           LKDAHLPELEPGDKIAIEKVGAYGSSMA-SQYNSRPKLLELALEDKI
1d7kA           VERCDLPEMHVGDWMLFENMGAYT-VAAASTFNGFQRPTIYYV----
1d7kB           VERCDLPEMHVGDWMLFENMGAYTV-AAASTFNGFQRPTIYYV----
3e5pB           RL---AEEVPVGPVVTLVGKDGNE-ENTLQMVAEKLET---------
3e5pA           RL---AEEVPVGPVVTLVGKDGNE-ENTLQMVAEKLETIHYEV----
1bd0B           RL---PGPLPVGTKVTIGRQGDEVISIDDVARHLETINYEVPCTISY
3btnA           VESCLLPELNVGDWLIFDNMGADSF-HEPSAFNDFQRPAIYFM----
3b8tA           DLG-PQAQDKAGDPVILWGEGLPVERIAEM-TKVSAYELITRLTS--
3b8vD           DLGPQAQ-DKAGDPVILERIKVSAYELI-------------------
3b8uB           DLGPQAQ-DKAGDPVILWGEGLPVERIAEM-TKVSAYELITRLTS--
3b8vA           D-LGPQAQDKAGDPVILWGEGLPVERIAEM-TKVSAYELITRLTS--
3btnB           VESCLLPELNVGDWLIFDNMGADSF-HEPSAFNDFQRPAIYFM----
3b8wA           DLGPQAQ-DKAGDPVILWGEGLPVERIAEM-TKVSAYELITRLTS--
3b8uA           DLGPQAQ-DKAGDPVILWGEGLPVERIAEM-TKVSAYELITRLT---
3b8vC           DL-GPQAQDKAGDPVILWGEGLPVERIM-TKVSAYELITRL------
3b8wD           DLGPQ-AQDKAGDPVILERIKVSAYELI-------------------
3b8uC           DLGPQAQ-DKAGDPVILERIKVSAYELITR-----------------
1bd0A           RL---PGPLPVGTKVTIGRQGDEVISIDDVARHLETINYEVPCTISY
2dy3A           SLGDNPHGVEAGAKAVIFGENGHD-----------------------
2dy3D           SLGDNPHGVEAGAKAVIFGENGHDA----------------------
3b8tD           DLGPQ-AQDKAGDPVILEMTKVSAYELITR--LTSRVAMKY------
3cpgA           -----------------------------------------------
3co8B           ------------YDLH-KHSGVPPWKIT-------------------
3co8A           ----------TLYDLHK-HSGVPPWKIT-------------------
2dy3B           SLGDNPHGVEAGAKAVIFGENGHD-----------------------
3b8uD           D-LGPQAQDKAGDPVILERIKVSAYELITR--LTSRVA-MKYV----
3b8tC           DLG-PQAQDKAGDPVILERIKVSAYELITRLTSRVAM----------
2dy3C           SLGDNPHGVEAGAKAVI------------------------------
3b8wC           QDKAGDPVILWGEGLPVERIKVSAYELITRLTSRVAM----------
1b54A           -----------------------------------------------
1ct5A           -----------------------------------------------
3bq6A           -----------------------------------------------
3bq5A           -----------------------------------------------
3bq5B           -----------------------------------------------
3bq6B           -----------------------------------------------