[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08007.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dhhA.bssp"
#ERROR : Can't open dsspfile "3d9bA.bssp"
#ERROR : Can't open dsspfile "3cuzA.bssp"
#ERROR : Can't open dsspfile "2c5mA.bssp"
#ERROR : Can't open dsspfile "3cv2B.bssp"
#ERROR : Can't open dsspfile "2axcA.bssp"
#ERROR : Can't open dsspfile "3btaA.bssp"
#ERROR : Can't open dsspfile "3cv2A.bssp"
#ERROR : Can't open dsspfile "1e6vB.bssp"
#ERROR : Can't open dsspfile "2d9rA.bssp"
#ERROR : Can't open dsspfile "1d8cA.bssp"
#ERROR : Can't open dsspfile "2axcA.bssp"

## Summary of PDB Search
:1044
      0.0  32%  2dhhA  [x.x.x] ACRB[MASQUE : MEMB(X) 253 / COIL(x) 0]
      0.0  32%  3d9bA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B[MASQUE : MEMB(X) 253 /
    3e-34   9%  3cuzA  [x.x.x] MALATE SYNTHASE A
    2e-32   8%  2c5mA  [x.x.x] CTP SYNTHASE
    1e-24   8%  3cv2B  [x.x.x] MALATE SYNTHASE A
    2e-18  12%  2axcA  [x.x.x] COLICIN E7
    2e-16   5%  3btaA  [d.92.1 - h.4.2 - b.29.1 - b.42.4] PROTEIN (BOTULINUM
    2e-14  12%  3cv2A  [x.x.x] MALATE SYNTHASE A
    5e-14  13%  1e6vB  [d.58.31 - a.89.1] METHYL-COENZYME M REDUCTASE I BETA SUBUNIT
    3e-12  14%  2d9rA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN
    3e-06  10%  1d8cA  [c.1.13] MALATE SYNTHASE G
    7e-09  18%  2axcA  [x.x.x] COLICIN E7(query 126->272)
:1044

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMH
2dhhA           MPNFFIDRXXXXXXXXXXXXXXXXXXXXXXXVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
3d9bA           MPNFFIDRXXXXXXXXXXXXXXXXXXXXXXXVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
3cuzA           -------------------------------AEDRFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIV
2c5mA           ----------------------------------------------------------------------
3cv2B           ------------------------------------------------------------VFQMDEILHA
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
1e6vB           ------------------------------------AEEVPIEVLSPMRNEAIQSIVNDIKRTVAVDLE-
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVS
2dhhA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
3d9bA           GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
3cuzA           GLNIFSYIKTLKNYPDRVLPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEEHNNQVL
2c5mA           ---------------------------------ILKSCGLHVTSIKIDPYINIDATKDNNLTTGKIYQYV
3cv2B           LRDHIVGLNCRWDYIFSYIKTLKNYPDRVLPDRQAVTMDKPFLNAYSRLLIKRGAAFIPSKDEEHNNQVL
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           -----------------------------------------------------GGMAAFIPSKDEEHNNQ
1e6vB           GIENALQNATVG------GKGMKIPGREMDVDIVDNAEAIADEIEKMIRVYQDDDTNVEPMYDGKRLLVQ
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           -------------------------------------------------------LPLDQATVSVTKRVT


                         +         .         .         .         .         *         .:210
query           LISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAEYALRVWFNPDQLNAYGLTTADVEAAIRARN
2dhhA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
3d9bA           VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
3cuzA           NKVKADKSLEANNGHDGTWIAHPGLADTAMAVFNDILSRKNQLEVMREQDAPITADQLLAPCDGERTEEG
2c5mA           INKKTVQVVPHITDAIQEWVMRQALIPEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVS
3cv2B           NKVKADKSLEANNGHDGTWIAHPGLADTAMAVFNDILSRKNQLEVMREQDAPITADQLLAPCDGERTEEG
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           VLNKVKADKSLEANNGHDGTWIAHPGLADTAMAVFNGSRKNQLEVMREQDAPITADQLLAPCDGERTRAN
1e6vB           LPSERVKVMADPYSGTLQAGMAVVHAIIDVCEVDMWDANMVKAAVFGRYDYFGGNVASMLDVPMKQEGVG
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           DVVKDTRQHIAVVAGVPSVPVV--NAKPTRTPGVFHASFPGVLTVSTVKGLPVSTTLPRGITEDKGRT--


                         .         .         .         +         .         .         .:280
query           GSVTPGQLGGAPSKPGQSYQAVVRPPAPLADPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTL
2dhhA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
3d9bA           AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
3cuzA           MRANIRVAVQYI-------EAWIS-----------GNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLS
2c5mA           LVPQPSSTGEQKTKPTQNSVRELR------GLGLSPDLVVCRCSNPLDTSVKEKISMFC-HVEPEQVICV
3cv2B           MRANIRVAVQYIEAWISGNGVPIY-------------------GLMEDAATAEISRTSIWQWIHHQKTLS
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           IRVAVQYIEAWISGNGVPIYGLMEDAA-----------------------TAEISRTSIWQWIHHQKTLS
1e6vB           YALRNIMVNHIVAATRKNTMQAVCLAATLQAMFEMGDAL----GPFERLHLLGYAYQGLNADNMVYD---
2d9rA           -------------------------------PIEFDAIIRQVPDDAAYVEIPFDVKTVYGKGRVRVNATF
1d8cA           ----------------------------------------------------RISSQHIANWLRHGILTK
2axcA           ------AVPAGFTFGGGSHEAVIRPKESGQKPVYVSVTDVLTPAVKQRQDEEKRLQQEWNDA--------


                         .         *         .         .         .         .         +:350
query           NGREAASMGLKLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLV
2dhhA           NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKXXXXXXXXXXXXXXXXX
3d9bA           NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKXXXXXXXXXXXXXXXXX
3cuzA           NGKPVTKALFRQMLGEEMKVIASELGEERFSQGRFDDAARL----MEQITTSDELIDFLTLPGYRL----
2c5mA           HDVSSIYRVPLLLEEQGVVDYFLRRLD-------------------------------------------
3cv2B           NGKPVTKALFRQMLGEEMKVIASELGEERFSQGRFDDAAR----LMEQITTSDELIDFLTLPGYRL----
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           NGKPVTKALFRQMLGEEMKVIASELGEERFSQGRFDDAAR----LMEQITTSDELIDFLTLPGYRL----
1e6vB           ----------------------------------------------------------------------
2d9rA           DGYPYT-GYIVRGLPCHILGLRQDIRRAI-------GKQPGDSVYVTL----------------------
1d8cA           EQVQASLENAKVVDQQNAGDPAYRPAGNFANSCAFKAASDLIFLGVKQPNGY------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
2dhhA           XXXXXXFLQNFRATLXXXXXXXXXXXXXXXXXXXXXXXINTLTMXXXXXXXXXXXXXXXXXXXXXXXVMA
3d9bA           XXXXXXFLQNFRATLXXXXXXXXXXXXXXXXXXXXXXXINTLTMXXXXXXXXXXXXXXXXXXXXXXXVMA
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EEGVDAFTAASRSMREVSGXXXXXXXXXXXXXXPMAFLGSAVGVIYRHFAMTLAISIAFSLFFALSLAPA
2dhhA           EEGLPPKEATRKSMGQIQGXXXXXXXXXXXXXXXXXXXXXXXGAIYRQFSITXXXXXXXXXXXXXXXXXX
3d9bA           EEGLPPKEATRKSMGQIQGXXXXXXXXXXXXXXXXXXXXXXXGAIYRQFSITIXXXXXXXXXXXXXXXXX
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           MCASLLRHGAQPARGPLAWFEHRFTAFTTRYAGWVXXXXXXXXXXXAVYLAMAAVCAVGLWQLPSGFLPE
2dhhA           XXXXXLKFG---------WFNRMFEKSTHHYTDSVGGILRSTGRXXXXXXXXXXXXXXXXXXXXXXXLPD
3d9bA           KPIAKGDHGEGKKG-FFGWFNRMFEKSTHHYTDSVGGILRSTGRXXXXXXXXXXXXXXXXXXXXXXXLPD
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKTSFALLGWNSGGSGEQRASVFLSLDDWKLR
2dhhA           EDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
3d9bA           EDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           -------------------------------------------------------------------SEI
3btaA           ----------------------------------------------------------------VNKQFN
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GRENAADVVLARLTKGLEEWPGRGDAQLYPYNGTALPELGSTSGLDMRLVTRLEGGRPSLYAARDKLIER
2dhhA           GEENKVEAITMRATRAFSQIKD---AMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAE
3d9bA           PGENKVEAITMRATRAFSQIKD---AMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARNQLLAE
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           AKDDPNSKIVTSLPAEVTNVQV---STLPLDQATSVTKRVTDVVKDTRQHIAVVAGVPSVPVVNAKP---
3btaA           PV-NGVDIAYIKIPNVGAFKIHNKIWVIPERDTFTNPDLNPPPEAKPVSYYDST-------YLSTDNEKD
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AKADPVFAEVRATAGQPVPALDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQAD
2dhhA           AAKHPMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
3d9bA           AAKHPMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           ----TRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTF----GGGSHEAVIRFP
3btaA           NYLKGVSTDLSIRGIPFWGGSTIDTELKVIDTNCIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVL
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           APFRMQPEDLARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLES
2dhhA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
3d9bA           AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYGSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           KESGQKPVYVSVTDVLTPAQQRQDEEKRLQQEWNDA----------------------------------
3btaA           NLTRNGYGSTQIRF--------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           LVRELGPDYEVRWSGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASAV
2dhhA           LASKLPTGVGYDWTGMSYQERLSGNXXXXXXXXXXXXXXXXXXXXXXXWSXXXXXXXXXXXXXXXXXXXX
3d9bA           LASKLPTGVGYDWTGMSYQERLSGNXXXXXXXXXXXXXXXXXXXXXXXWSXXXXXXXXXXXXXXXXXXXX
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           WLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLEXXXXXXXXXXXXXXPVVMTSLAFILGVV
2dhhA           XXXGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGLIEATLDAVRMRLXXXXXXXXXXXXXXX
3d9bA           XXXGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGLIEATLDAVRMRLXXXXXXXXXXXXXXX
3cuzA           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
1e6vB           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           PLAISTGPGAGAQRAVGTGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dhhA           XXXXXXXXGSGAQNAVGTG---------------------------------------------
3d9bA           XXXXXXXXGSGAQNAVGTG---------------------------------------------
3cuzA           ----------------------------------------------------------------
2c5mA           ----------------------------------------------------------------
3cv2B           ----------------------------------------------------------------
2axcA           ----------------------------------------------------------------
3btaA           ----------------------------------------------------------------
3cv2A           ----------------------------------------------------------------
1e6vB           ----------------------------------------------------------------
2d9rA           ----------------------------------------------------------------
1d8cA           ----------------------------------------------------------------
2axcA           ----------------------------------------------------------------