[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08055.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e0mC.bssp"
#ERROR : Can't open dsspfile "3bqgA.bssp"
#ERROR : Can't open dsspfile "3bqhA.bssp"
#ERROR : Can't open dsspfile "3bqfA.bssp"
#ERROR : Can't open dsspfile "3bqeA.bssp"
#ERROR : Can't open dsspfile "3e0mA.bssp"
#ERROR : Can't open dsspfile "2a1sA.bssp"
#ERROR : Can't open dsspfile "3cssA.bssp"
#ERROR : Can't open dsspfile "1aw0A.bssp"
#ERROR : Can't open dsspfile "1afiA.bssp"

## Summary of PDB Search
:243
    1e-55  31%  3e0mC  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    9e-47  39%  3bqgA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    2e-46  42%  3bqhA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    6e-46  41%  3bqfA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    2e-45  43%  3bqeA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    8e-45  29%  3e0mA  [x.x.x] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA/MSRB
    1e-34  13%  2a1sA  [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
    3e-30  10%  3cssA  [x.x.x] 6-PHOSPHOGLUCONOLACTONASE
    3e-08  23%  1aw0A  [x.x.x] MENKES COPPER-TRANSPORTING ATPASE
    2e-07  29%  1afiA  [x.x.x] MERP
:243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHTETAVFAGGCFWG
3e0mC           --------------------------------------------------------HMAEIYLAGGCFWG
3bqgA           ---------------------------------------------------------NTRTIYLAGGFWG
3bqhA           --------------------------------------------------------NTRTIYLAGGCFWG
3bqfA           ---------------------------------------------------------TRTIYLAGGSFWG
3bqeA           ---------------------------------------------------------TRTIYLAGGCFWG
3e0mA           ----------------------------------------------------------AEIYLAGGCFWG
2a1sA           --------------------------------------------------------------------SN
3cssA           ----------------------------------------------------------ICENLSQMSFAA
1aw0A           ---------------------------------------------------------TQETVINNSCVQS
1afiA           ---------------------------------------------------------TQTVTLAAACPIT


                         .         .         *         .         .         .         .:140
query           VQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQL
3e0mC           LEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRV-IDPLSI
3bqgA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFR-VVDPTSL
3bqhA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFR-VVDPTSL
3bqfA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRV-VDPTSL
3bqeA           LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRV-VDPTSL
3e0mA           LEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRV-IDPLSI
2a1sA           FKSNLHKVYQAIEIDGEFSGISDGFDTPEERYQKLKKHSMDFLLVFPKPFNRSSPDVKFVCQS-SSIDFL
3cssA           REVILAAIDARVPVVLALSGGSTPKRLYEELHEKDLALLQQHAVQFEDDEQSNFSMATKALLR-DVPSS-
1aw0A           IEGVISKKPGVKSIRVSLANS-------------------NGTVEYDPLLTSPETLRG------------
1afiA           VKKALSKVEGVSKVDVGFEKR-------------------EAVVTFDDTKASVQKLTK------------


                         +         .         .         .         .         *         .:210
query           NYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSY
3e0mC           NQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQ--ERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSY
3bqgA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKRE--QQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPN-
3bqhA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNG
3bqfA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPN-
3bqeA           NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKRE--QQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPN-
3e0mA           NQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQ--ERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSG
2a1sA           ASQGFDFNKVFRNGIPYLNQEEERQLREPVTIPEDQKKFIDQVVEKIED---LLQSEENKNLDLEPCTGF
3cssA           --DVISIDRRAALATSKDEKGGLDGAWAVAQDYE--VKLLNCLPCKQINGT-AKSVPVVDIVLLGFGSDG
1aw0A           ----------------------------------------------------------------------
1afiA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PYIVINDLPKIGNLKTMFPDVYRNDxxxxxxxx
3e0mC           CHIDVTDADKPLIDAANYEKPSQEV--------
3bqgA           GYSHIDIRKA-----------------------
3bqhA           YCIRKADEPL-----------------------
3bqfA           GYCHIDIRKADEPLP------------------
3bqeA           GYCHIDIRKA-----------------------
3e0mA           YCHIDVTDADKPLIDAANYEKPSQ---------
2a1sA           QRKLIYQTLSW----------------------
3cssA           HT-------------------------------
1aw0A           ---------------------------------
1afiA           ---------------------------------