[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08099.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d3hA.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "3bicB.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "2djxA.bssp"
#ERROR : Can't open dsspfile "2e68B.bssp"
#ERROR : Can't open dsspfile "2b4gB.bssp"
#ERROR : Can't open dsspfile "3c61A.bssp"
#ERROR : Can't open dsspfile "3c3nA.bssp"
#ERROR : Can't open dsspfile "2djlA.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "2b4gA.bssp"
#ERROR : Can't open dsspfile "2e68A.bssp"
#ERROR : Can't open dsspfile "2a4aA.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "3bllA.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "1bwlA.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "3c5xA.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "3c6eA.bssp"
#ERROR : Can't open dsspfile "2bbfA.bssp"
#ERROR : Can't open dsspfile "2bwgD.bssp"
#ERROR : Can't open dsspfile "2a7nA.bssp"
#ERROR : Can't open dsspfile "2a4aB.bssp"
#ERROR : Can't open dsspfile "2ekcA.bssp"
#ERROR : Can't open dsspfile "1ea0A.bssp"
#ERROR : Can't open dsspfile "2c6qB.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "3b5vA.bssp"
#ERROR : Can't open dsspfile "2dztB.bssp"
#ERROR : Can't open dsspfile "2bwgA.bssp"
#ERROR : Can't open dsspfile "2dzuB.bssp"
#ERROR : Can't open dsspfile "1b3oA.bssp"
#ERROR : Can't open dsspfile "2dzxB.bssp"
#ERROR : Can't open dsspfile "2a7rA.bssp"
#ERROR : Can't open dsspfile "2dzpB.bssp"
#ERROR : Can't open dsspfile "1a0dA.bssp"
#ERROR : Can't open dsspfile "3ct7A.bssp"
#ERROR : Can't open dsspfile "2bleA.bssp"
#ERROR : Can't open dsspfile "3dz1A.bssp"
#ERROR : Can't open dsspfile "1a53A.bssp"
#ERROR : Can't open dsspfile "1ak5A.bssp"
#ERROR : Can't open dsspfile "1dbtB.bssp"
#ERROR : Can't open dsspfile "2c3zA.bssp"
#ERROR : Can't open dsspfile "2dzwB.bssp"
#ERROR : Can't open dsspfile "2a7rC.bssp"
#ERROR : Can't open dsspfile "2e09B.bssp"
#ERROR : Can't open dsspfile "2bwgB.bssp"
#ERROR : Can't open dsspfile "2dzvA.bssp"
#ERROR : Can't open dsspfile "2dzpA.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1dvjC.bssp"
#ERROR : Can't open dsspfile "1dxiA.bssp"
#ERROR : Can't open dsspfile "2dzsA.bssp"
#ERROR : Can't open dsspfile "2dzsB.bssp"
#ERROR : Can't open dsspfile "3cu2A.bssp"
#ERROR : Can't open dsspfile "2dzuA.bssp"
#ERROR : Can't open dsspfile "2dzvB.bssp"
#ERROR : Can't open dsspfile "2cu0B.bssp"
#ERROR : Can't open dsspfile "2a7rD.bssp"
#ERROR : Can't open dsspfile "2a1yA.bssp"
#ERROR : Can't open dsspfile "2e09A.bssp"
#ERROR : Can't open dsspfile "2cffA.bssp"
#ERROR : Can't open dsspfile "2dzwA.bssp"
#ERROR : Can't open dsspfile "2cu0A.bssp"
#ERROR : Can't open dsspfile "2bznA.bssp"
#ERROR : Can't open dsspfile "2dzxA.bssp"
#ERROR : Can't open dsspfile "2c6qA.bssp"
#ERROR : Can't open dsspfile "2a7rB.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"
#ERROR : Can't open dsspfile "1dvjA.bssp"
#ERROR : Can't open dsspfile "2dztA.bssp"
#ERROR : Can't open dsspfile "3c2zA.bssp"
#ERROR : Can't open dsspfile "2c6qG.bssp"
#ERROR : Can't open dsspfile "1eepA.bssp"
#ERROR : Can't open dsspfile "2bznD.bssp"
#ERROR : Can't open dsspfile "1chrA.bssp"
#ERROR : Can't open dsspfile "2btmA.bssp"
#ERROR : Can't open dsspfile "1dbtA.bssp"
#ERROR : Can't open dsspfile "2bznB.bssp"
#ERROR : Can't open dsspfile "2dw7A.bssp"
#ERROR : Can't open dsspfile "1btmA.bssp"
#ERROR : Can't open dsspfile "1dvjB.bssp"
#ERROR : Can't open dsspfile "2ekcB.bssp"
#ERROR : Can't open dsspfile "3dwjA.bssp"
#ERROR : Can't open dsspfile "2ashA.bssp"
#ERROR : Can't open dsspfile "3e7mA.bssp"
#ERROR : Can't open dsspfile "3e7sA.bssp"
#ERROR : Can't open dsspfile "1eepB.bssp"
#ERROR : Can't open dsspfile "3e7gA.bssp"
#ERROR : Can't open dsspfile "3bggA.bssp"
#ERROR : Can't open dsspfile "2aqwA.bssp"
#ERROR : Can't open dsspfile "3egbB.bssp"
#ERROR : Can't open dsspfile "3c0jA.bssp"
#ERROR : Can't open dsspfile "1ad1B.bssp"

## Summary of PDB Search
:358
    1e-49  40%  1d3hA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    2e-44  38%  1d3gA  [c.1.4] DIHYDROOROTATE DEHYDROGENASE
    7e-42   9%  3bicB  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    2e-33  12%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    3e-32  13%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    2e-26  22%  2djxA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    3e-26  22%  2e68B  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-25  24%  2b4gB  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    5e-25  22%  3c61A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    9e-25  23%  3c3nA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    1e-24  21%  2djlA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-24  12%  2e77B  [x.x.x] LACTATE OXIDASE
    1e-23  23%  2b4gA  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    9e-23  22%  2e68A  [x.x.x] DIHYDROOROTATE DEHYDROGENASE
    2e-21   9%  2a4aA  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    3e-21  12%  2e77C  [x.x.x] LACTATE OXIDASE
    2e-20  14%  3bllA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    2e-20  11%  2e77A  [x.x.x] LACTATE OXIDASE
    3e-20  10%  1bwlA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    3e-18  10%  1bwkA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    6e-18  12%  2du2A  [x.x.x] LACTATE OXIDASE
    6e-18  22%  3c5xA  [x.x.x] ENVELOPE PROTEIN E
    1e-17  13%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    1e-17  22%  3c6eA  [x.x.x] ENVELOPE PROTEIN E
    3e-17  12%  2bbfA  [x.x.x] TRNA GUANINE TRANSGLYCOSYLASE
    8e-17  11%  2bwgD  [x.x.x] GMP REDUCTASE I
    2e-16  12%  2a7nA  [x.x.x] L(+)-MANDELATE DEHYDROGENASE
    2e-16   9%  2a4aB  [x.x.x] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    4e-16  14%  2ekcA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-15   6%  1ea0A  [d.153.1 - c.1.4 - b.80.4] GLUTAMATE SYNTHASE [NADPH] LARGE
    2e-15  13%  2c6qB  [x.x.x] GMP REDUCTASE 2
    7e-15  11%  1al7A  [x.x.x] GLYCOLATE OXIDASE
    2e-13  11%  3b5vA  [x.x.x] RETROALDOLASE-22
    1e-12  14%  2dztB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-12  11%  2bwgA  [x.x.x] GMP REDUCTASE I
    4e-12  13%  2dzuB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-12  16%  1b3oA  [c.1.5] PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)
    6e-12  13%  2dzxB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    8e-12  12%  2a7rA  [x.x.x] GMP REDUCTASE 2
    2e-11  14%  2dzpB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-11  12%  1a0dA  [c.1.15] XYLOSE ISOMERASE
    2e-11  16%  3ct7A  [x.x.x] D-ALLULOSE-6-PHOSPHATE 3-EPIMERASE
    1e-10  11%  2bleA  [x.x.x] GMP REDUCTASE I
    1e-10  14%  3dz1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-10  11%  1a53A  [c.1.2 (1lbfA)] INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE
    4e-10  11%  1ak5A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    4e-10  10%  1dbtB  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    5e-10  12%  2c3zA  [x.x.x] INDOLE-3-GLYCEROL PHOSPHATE SYNTHASE
    1e-09  13%  2dzwB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-09  12%  2a7rC  [x.x.x] GMP REDUCTASE 2
    3e-09  13%  2e09B  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-09  12%  2bwgB  [x.x.x] GMP REDUCTASE I
    6e-09  13%  2dzvA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    8e-09  12%  2dzpA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-08  12%  1efzA  [c.1.20] TRNA-GUANINE TRANSGLYCOSYLASE
    1e-08  11%  1dvjC  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    1e-08   7%  1dxiA  [c.1.15] D-XYLOSE ISOMERASE
    2e-08  15%  2dzsA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    3e-08  13%  2dzsB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-08   8%  3cu2A  [x.x.x] RIBULOSE-5-PHOSPHATE 3-EPIMERASE
    5e-08  14%  2dzuA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    6e-08  15%  2dzvB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-08  18%  2cu0B  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    2e-07  15%  2a7rD  [x.x.x] GMP REDUCTASE 2
    2e-07  21%  2a1yA  [x.x.x] GMP REDUCTASE
    2e-07  15%  2e09A  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    4e-07  10%  2cffA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    4e-07  12%  2dzwA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    7e-07  18%  2cu0A  [x.x.x] INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    1e-06  16%  2bznA  [x.x.x] GMP REDUCTASE 2
    2e-06  21%  2dzxA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    2e-06  15%  2c6qA  [x.x.x] GMP REDUCTASE 2
    2e-06  13%  2a7rB  [x.x.x] GMP REDUCTASE 2
    2e-06  16%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
    2e-06  12%  1dvjA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    5e-06  20%  2dztA  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    5e-06  14%  3c2zA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    8e-06  17%  2c6qG  [x.x.x] GMP REDUCTASE 2
    8e-06  18%  1eepA  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    1e-05  11%  2bznD  [x.x.x] GMP REDUCTASE 2
    1e-05  16%  1chrA  [d.54.1 - c.1.11] CHLOROMUCONATE CYCLOISOMERASE
    3e-05   8%  2btmA  [c.1.1] PROTEIN (TRIOSEPHOSPHATE ISOMERASE)
    3e-05  12%  1dbtA  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    3e-05  17%  2bznB  [x.x.x] GMP REDUCTASE 2
    4e-05  13%  2dw7A  [x.x.x] BLL6730 PROTEIN
    7e-05   6%  1btmA  [c.1.1] TRIOSEPHOSPHATE ISOMERASE
    7e-05  12%  1dvjB  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    9e-05  21%  2ekcB  [x.x.x] TRYPTOPHAN SYNTHASE ALPHA CHAIN
    1e-04  10%  3dwjA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    1e-04  17%  2ashA  [x.x.x] QUEUINE TRNA-RIBOSYLTRANSFERASE
    1e-04  12%  3e7mA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    2e-04   8%  3e7sA  [x.x.x] NITRIC OXIDE SYNTHASE, ENDOTHELIAL
    2e-04  16%  1eepB  [c.1.5] INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
    4e-04  13%  3e7gA  [x.x.x] NITRIC OXIDE SYNTHASE, INDUCIBLE
    4e-04   9%  3bggA  [x.x.x] URIDINE 5'-MONOPHOSPHATE SYNTHASE
    5e-04   8%  2aqwA  [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
    5e-04   9%  3egbB  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    6e-04  17%  3c0jA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    9e-04  18%  1ad1B  [c.1.21] DIHYDROPTEROATE SYNTHETASE
:358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxLVLNALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPRTVMGVR
1d3hA           -------------------EHLMPTLQGLLDPESAHRLAV------RFTSLGLLPFQDSDMLEVRVLGHK
1d3gA           -----------------YAEHLMPTLQGLLDPESAHRLAVR-FTSLGLL-----PFQDSDMLEVRVLGHK
3bicB           ----------------------------------------------------------------------
1djnA           -------------------------------------------------------------EPIQIGPKT
1djqA           -------------------------------------------------------------EPIQIGPKT
2djxA           ------------------------------------------------------------CLKLNLLDHV
2e68B           ------------------------------------------------------------CLKLNLLDHV
2b4gB           ------------------------------------------------------------SLKVNILGHE
3c61A           ------------------------------------------------------------SLQVDLLNNT
3c3nA           ----------------------------------------------------------------NLLDHV
2djlA           ------------------------------------------------------------CLKLNLLDHV
2e77B           -----------------------------SGDEWTKRANDRAWKHKLLYPRL-AQDVEAPDTSTEILGHK
2b4gA           --------------------------------------------------------------KVNILGHE
2e68A           ------------------------------------------------------------CLKLNLLDHV
2a4aA           ----------------------------------------------------------------------
2e77C           -----------------------------SGDEWTKRANDRAWKHKLLYPRLA-QDVEAPDTSTEILGHK
3bllA           ----------------------------------------------------------------EMKRGV
2e77A           -------------EASKVVPHGGFNYIAGSGDEWTKRANDRAWKHKLLYPRL-AQDVEAPDTSTEILGHK
1bwlA           -------------------------------------------------------------KPIKIGNNE
1bwkA           --------------------RAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAPGTMIITEGAFISPQAGG
2du2A           -----------------------------SGDEWTKRANDRAWKHKLLYPRLA-QDVEAPDTSTEILGHK
3c5xA           ----------------------------------------------------------------------
1al8A           -----------------------------AEDQWTLAENRNAFSRILFRPRI-LIDVTNIDMTTTILGFK
3c6eA           ----------------------------------------------------------------------
2bbfA           ----------------------------------------------------------------------
2bwgD           ---------------------------------------------------------------KDVLLRP
2a7nA           -----------------MVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKR----LVDVSRRSLQAEVLGKR
2a4aB           ----------------------------------------------------------------------
2ekcA           ----------------------------------------------------------------------
1ea0A           ----------------------------SYTTFKKYSEQVNKRPPMQLRDLLELSTKAPVPVDEVESITA
2c6qB           ----------------------------------------------------------------------
1al7A           -----------------------------AEDQWTLAENRNAFSRILFRPRI-LIDVTNIDMTTTILGFK
3b5vA           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
2bwgA           --------------------------------------------------------RIDADLKLDFKDVL
2dzuB           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
2a7rA           ----------------------------------------------------------------------
2dzpB           ----------------------------------------------------------------------
1a0dA           -------------------------AFKFYNPEEKVGDKT----MEEHLRFSVAYWHTFTGDGSDPFGAG
3ct7A           ----------------------------------------------------------------------
2bleA           ---------------------------------------------------------------KDVLLRP
3dz1A           ----------------------------------------------------------------------
1a53A           ----------------------------------------------------------------------
1ak5A           ----------------------------------------------------------------------
1dbtB           ----------------------------------------------------------------------
2c3zA           ----------------------------------------------------------------------
2dzwB           ----------------------------------------------------------------------
2a7rC           ----------------------------------------------------------------------
2e09B           ----------------------------------------------------------------------
2bwgB           --------------------------------------------------------RIDADLKLDFKDVL
2dzvA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1dvjC           ----------------------------------------------------------------------
1dxiA           ----------------------------------------------------------------------
2dzsA           ----------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
3cu2A           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
1dvjA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
3c2zA           ----------------------------------------------------------------------
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2bznD           ----------------------------------------------------------------------
1chrA           ----------------------------------------------------------------------
2btmA           ----------------------------------------------------------------------
1dbtA           ----------------------------------------------------------------------
2bznB           ----------------------------------------------------------------------
2dw7A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
1dvjB           ----------------------------------------------------------------------
2ekcB           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
2ashA           ----------------------------------------------------------------------
3e7mA           ----------------------------------------------------------------------
3e7sA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
3e7gA           ----------------------------------------------------------------------
3bggA           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3c0jA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
1d3hA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
1d3gA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
3bicB           -----------------------ARIDSGSEVIVGVNKYQLEKEDTVEVDNTSVRNRQIEKLKKIKSS--
1djnA           LRNRFYQVPHPGFQSAHRSVKAEGGWAALNTEYCSINPESDDTHRLSARIWDEGDVLAGVELWYGGAHAP
1djqA           LRNRFYQVPHPGFQSAHRSVKAEGGWAALNTEYCSINPESDDTHRLSARIWDEGDVLAGVELWYGGAHAP
2djxA           FANPFMNAAVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
2e68B           FANPFMNAAVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
2b4gB           FSNPFMNAAGLCTTEEDLRRMTESESGSLIGKSCTLAPRTGNPEPRYFGLP--LGSINSMGLPNLGVDFY
3c61A           FANPFMNAAVMCSTTEDLVAMTESASGSLVSKSCTPALREGNPTPRYRALPLGS--INSMGLPNNGFDFY
3c3nA           FANPFMNAAVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAVP--LGSINSMGLPNLGFDFY
2djlA           FANPFMNAAVLCCTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
2e77B           IKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQN
2b4gA           FSNPFMNAAVLCTTEEDLRRMTESESGSLIGKSCTLAPRTGNPEPRYFG--LPLGSINSMGLPNLGVDFY
2e68A           FANPFMNAAVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGS--INSMGLPNLGFDFY
2a4aA           -------------------------ICLTDHTFLDENGT-EDDIRELCNESVKTCPFAAAVCVYPKFVKF
2e77C           IKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQN
3bllA           IRTPAFMPVGTAATALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGF--
2e77A           IKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKDDQQN
1bwlA           LLHRAVIPPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGYDNAPGVWSEEQMVEWTWAAFPDNLARDG
1bwkA           YDNAPGVMVEWTKIFNAIH--EKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKA
2du2A           IKAPFIMAPIAAHGLAHTTKEAGTARAVSEFGTIMSISAYSGATFEEISEGLNGGPRWFQIYMAKD---D
3c5xA           ----------------------------------------------------------------------
1al8A           ISMPIMIAPTAMQKMAHPEGEYATARAASAAGT--IMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNV
3c6eA           ----------------------------------------------------------------------
2bbfA           ----------AAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKPETVRATGADIILGNTYHLKLGGLHS
2bwgD           KRSSLKSRAEVDLERT-FTFRNSKQTYSGIPIIVANMDTVGTFE--MAAVMSQHSMFTAIHKHYSLDDWK
2a7nA           QSMPLLIGPTALNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQG
2a4aB           --------------------------CLTDHTFLDENGTEDDIR-ELCNESVKTCPFAAAVCVYPKFVKF
2ekcA           -----------------------------------------GRISDKFTELKEKRLVSYLMVGYPDYETS
1ea0A           IRKRFITPGM-SMGALSPEAHGTLNVAMNRIGAKSDSGEGGEDPARFRPDKNGDNWNSAIKQVASGRFGV
2c6qB           --------------------------------TLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGT
1al7A           ISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVE--EVASTGPGIRFFQLYVYKDRNV
3b5vA           ----------------------------------------------------------------------
2dztB           ----------------------------------------------------------------------
2bwgA           LPKRSSLKSRAEVD--LERTFTFRNSKQTYSGIIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWK
2dzuB           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
2a7rA           --------------------------------TLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGT
2dzpB           ----------------------------------------------------------------------
1a0dA           MIRPWNMDLAKARVEAAFEFFEKLNIPFFCFHDVDIAPEGETLKETYKNLDIIVDMIEEYMKTSKTK---
3ct7A           ----------------------------------------------------------------------
2bleA           KRSSLKSRAEVDLERT-FTFRNSKQTYSGIPIIVAN--MDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWK
3dz1A           ----------------------------------------------------------------------
1a53A           ---------------------------------------------GWLKDVVQLSLRRPSFRASRQRPII
1ak5A           ----------------------------------------------------------------------
1dbtB           --NLPIIALDFASAEETLAFLAPFQQEPLFVKVGMELFYQEGPSIVKQLKERNCELFLDLKLHDIPTTVN
2c3zA           ----------------------------------------------------------------------
2dzwB           ----------------------------------------------------------------------
2a7rC           --------------------------------TLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGT
2e09B           ----------------------------------------------------------------------
2bwgB           LPKRSSLKSRAEVDLE--RTFTFRNSKQTYSGIIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWK
2dzvA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1efzA           ----------------------------------------------------------------------
1dvjC           ----------------------------------------------------------------------
1dxiA           -----------------VQRLAELGAYGVTFHDDDLIPFGSSDTERESHIKRFRQALDATGMTVPMATTN
2dzsA           ----------------------------------------------------------------------
2dzsB           ----------------------------------------------------------------------
3cu2A           ----------------------------------------------------------------------
2dzuA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2a7rB           ----------------------------------------------------------------------
1b3oB           ----------------------------------------------------------------------
1dvjA           ----------------------------------------------------------------------
2dztA           ----------------------------------------------------------------------
3c2zA           -----------TVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQV
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2bznD           ----RPKRSTLEVDLT-RSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQ
1chrA           ----------------------------------------------------------------------
2btmA           ----------------------------------------------------------------------
1dbtA           --NLPIIALDFASAEETLAFLAPFQQEPLFVKVGMELFYQEGPS-------------------------I
2bznB           ----------------------------------------------------------------------
2dw7A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
1dvjB           ----------------------------------------------------------------------
2ekcB           ----------------------------------------------------------------------
3dwjA           ----------------------------------------------------------------------
2ashA           ----------------------------------------------------------------------
3e7mA           ----------------------------------------------------------------------
3e7sA           ----------------------------------------------------------------------
1eepB           ----------------------------------------------------------------------
3e7gA           ----------------------------------------------------------------------
3bggA           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3c0jA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
1d3hA           EHRLRARQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL
1d3gA           EHRLRARQQKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLL
3bicB           -RDQALAERCLAALTECAASGDGNILALAVDASRARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFGE
1djnA           NMESRAFETLSYCKEMDLSDIAQVQQFYVDAAKDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGS-L
1djqA           NMESRATPRLSYCKEMDLSDIAQVQQFYVDAAKDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGS-L
2djxA           LKYASD-LHDYSKKPLFLSISGLSV---EENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEA
2e68B           LKYASD-LHDYSKKPLFLSISGL---SVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAY--DF
2b4gB           LSYAAQ-THDYSRKPLFLSMSGLS---VEESVEMVKKLVPITKEKGTILELNLSCPNVPGKPQVGYDFD-
3c61A           LAYAAE-QHDYGRKPLFLSMSGLSV---RENVEMCKRLAAVATEKGVILELNLSCPNVPGKPQVYDFDAM
3c3nA           LKYASD-LHDYSKKPLFLSISGLSVEENVA---MVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFE-
2djlA           LKYASDLHDYSKK-----PLFLSISGLSEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEA
2e77B           RDILDEAKSDGAT-----AIILTADSTVSGNRDRDVKNKFVYPFGMPIVQRYLRGTAEGMSLNNIYGASK
2b4gA           LSYAAQ-THDYSRKPLFLSMSGLSV---EESVEMVKKLVPITKEKGTILELNLSCPNVPGKPQVGYDFDT
2e68A           LKYASDLH---DYSKKPLFLSISGLSV-EENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEM
2a4aA           INEKIKQEINPFKPKIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIENTDEGLKEATKL
2e77C           RDILDEAK---SDGATAIILTADSTVSGNRDRDVKNKFVYPFGMIYGASKQKISPRDIEEIAGHSG----
3bllA           -------QVQSEEGV----TFKSMLSPERSIEIQHLLGSDIVMAFD----EVTPYPATPSRAASSMERSM
2e77A           RDILDEAKSDGATAIIL-----TADSTVSGNRDRDVKNKFVYPFGMPIVQNNIYGAS-----------KQ
1bwlA           LRYDSASDNVFMDAEQEAKAKKANNPQHSKNSIAAGADGVEINSAHGYLLNQFLDPHSNTRTDEYGGSIE
1bwkA           NNPQHSLTKD-----EIKQYIKEYVQAAKNSIAAGADGVE-INSANGYLLNQFLDPHSNTRTDEYGGS-I
2du2A           QQNRDILDEAKSDGATAIILTADSTVSGNRDRD---VKNKFVYPFGMPIVQRYLRGTAEGMSLNNIYGAS
3c5xA           ------------------------------------------YFQGMRC-IGMS--NRDFVEGVSGGSWV
1al8A           VAQLVRRAERA---------------------------------GFKAIALTVDTPRLIKNRFVLPPFLT
3c6eA           ------------------------------------------YFQGMR-CIGM--SNRDFVEGVSGGSWV
2bbfA           FMGWDRPILTDSGGYQVMEGVTFKSHLSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPS-RAASSM
2bwgD           LFATNHPECLQNVAV---SSGSGQNDL------EKMTSILEAVPQVKFICLDVANGYSEHFVEFVKL---
2a7nA           MVLK---ALHTGYTTLVLTTDVAVN-GYRERDLHNRFKIPPFLTLKNFEGIDLGKMDKANLEMQAALMSR
2a4aB           INEKIKQEINPFKPKIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIENTDEGLKEATKL
2ekcA           LKAFKEVL---KNGTDILEIGFPFSDPVADGPTIQV-AHEVALKNGIRFEDVLELSETLRKEFPDIPFLL
1ea0A           TAEYLNQCR--ELEIKVAQGAKPGEGGQLPGFKVTEM-----IARLRHSTPGVMLISPPPHHDIYS----
2c6qB           FEMAKVLC---KFSLFTAVHKHYSLVQWQEFAGQNPDCLEHL-----------AASSGTGSSDFEQLEQI
1al7A           VAQLVRRAERA---------------------------------GFKAIALTVDTPRLGRREADIKNRFV
3b5vA           ---------------------DRKSPSGLDVERDPIEYSKFMERYAVGLSITTEAKYFNGLRAIASSVSI
2dztB           ----------------------------------------------------------------------
2bwgA           LFATNHPECLQNVAV---SSGSGQNDL------EKMTSILEAVPQVKFICLDVANGYSEHFVEFVKL---
2dzuB           ----------------------------------------------------------------------
1b3oA           ----------------------------------------------------------------------
2dzxB           ----------------------------------------------------------------------
2a7rA           FEMAKVLCKFSLFTAVHKHYSLV---QWQEFAGQNPDCLEHL-----------AASSGTGSSDFEQLEQI
2dzpB           ----------------------------------------------------------------------
1a0dA           LLWNTANLFTHPRFV-HGAATSCNADVFAYAAAKVKKGLEIAKRLAENYVFWGGREGYETLLNTDMKLEL
3ct7A           --------------------------------------------HADYFHIDIMDGHFVPNLQVKKLATK
2bleA           LFATNHPECLQNVAVS---SGSGQNDLE------KMTSILEAVPQVKFICLDVANGYSEHFVEFVKLV--
3dz1A           ----------------------------------------------------------------------
1a53A           SLNERILEFNKRNIT-AIIAEYKRKSPSGLDVERDPIEYSKFMERAVGLSILTEEKYFNGLRKIASSVSI
1ak5A           ----------------------------------------------------------------------
1dbtB           -----------------------------------KAMKRLASLGVDLVNVHAAGGKKMMQAALEGLEEG
2c3zA           ---------NKRNITAIIAEYKRKSPSGLDVERDPIEYSKFMERYAVGLSILTEEKYFNGLRKIASSVSI
2dzwB           ----------------------------------------------------------------------
2a7rC           FEMAKVLCKFSLFTAVH---KHYSLVQWQEFAGQNPDCLEHLAA-----------SSGTGSSDFEQLEQI
2e09B           ----------------------------------------------------------------------
2bwgB           LFATNHPECLQNVAVS---SGSGQNDLEKMTS------ILEAVPQVKFICLDVANGYSEHFVEFVKL---
2dzvA           ----------------------------------------------------------------------
2dzpA           ----------------------------------------------------------------------
1efzA           ---------------------------------------------SDIVMAFDECTPYPATPS-RAASSM
1dvjC           --------------------------------DDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKR
1dxiA           LFTHPVFKD--------GGFTANDRDVRRYALRKTIGNIDLAELGAKTYVAWGGREGAESGGAKDVRDAL
2dzsA           ------------------------------DKQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESHY
2dzsB           ----------------------------------------------------------------------
3cu2A           ---NEEVTTLLENQINVLHFD-IADGQFSSLFTVGAIGIKYFPTHCFKDVHLVRNQLEVAKAVVANGANL
2dzuA           ----------------------------------------------------------------------
2dzvB           ----------------------------------------------------------------------
2cu0B           ----------------------------------------------------------------------
2a7rD           ----------------------------------------------------------------------
2a1yA           ----------------------------------------------------------------------
2e09A           ----------------------------------------------------------------------
2cffA           ----------------------------------------------------------------------
2dzwA           ----------------------------------------------------------------------
2cu0A           ----------------------------------------------------------------------
2bznA           ----------------------------------------------------------------------
2dzxA           ----------------------------------------------------------------------
2c6qA           ----------------------------------------------------------------------
2a7rB           -------------------------------------------------------SSGTGSSDFEQLEQI
1b3oB           ----------------------------------------------------------------------
1dvjA           --------------------------------DDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKR
2dztA           ----------------------------------------------------------------------
3c2zA           MQSEEGVTRHMLSPERSIEIQHLLGSDIVMAFD-----------ECTPYPATPSRAASSMERSMRWAKR-
2c6qG           ----------------------------------------------------------------------
1eepA           ----------------------------------------------------------------------
2bznD           EFAGQNPDCLEHLAA-SSGTGSSDFEQLEQILEAIPQVKYICLDVA--------------------NGYS
1chrA           ----------------------------------------------------------------------
2btmA           ----------------------------------------------------------------------
1dbtA           VKQLKERNCELFLDLKLHDIPTTVNKAMKRLASL----------GVDLVNVHAAGGKKMMQAALEGLEEG
2bznB           ----------------------------------------------------------------------
2dw7A           ----------------------------------------------------------------------
1btmA           ----------------------------------------------------------------------
1dvjB           ----------------------------------------------------------------------
2ekcB           ----------------------------------------------------------------------
3dwjA           --------------------------DKPTPLEELLPHAIEINQYYGSFKEAKIEEHLARLEAVTKEIET
2ashA           ----------------------------------------------------------------------
3e7mA           ---------------------------KPTPLEELLPHAIEFINQYGSFKEAKIEE--HLARLEAVTKEI
3e7sA           -----------------------------------------------------SIKRSGSQAHEERLEVA
1eepB           ----------------------------------------------------------------------
3e7gA           ----------------------------------------------------------------------
3bggA           ----------------------------------------------------------------------
2aqwA           -----------------------------------------------------------------KSDSC
3egbB           -------------------------------------------RNQTVVVEYTHDKDTDMFQVGRSTESP
3c0jA           ----------------------------------------------------------------------
1ad1B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSLLSTLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIATNTTISRDAVKGLPHA
1d3hA           RRLLTKVLQERD--GLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALR
1d3gA           TKVLQERDG------LRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALR
3bicB           SKEITSAIKRVHKFMERGRRPRLLVAKMGQDGHDRGAKVIATGFADLGFDDIGPLFQTPREVAQQAVDAD
1djnA           ENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAEVDGQKFVEMADSLVDMWDITIG-DIAEW
1djqA           ENRARFWLETLEKVKHAVGSDCAIATRFGVDIEAEVDGQKFVEMADSLVDMWDITIGDIAEWGEDAGPSR
2djxA           MRTYLQQVSLAYG--------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIVIKPK
2e68B           EAMRTYLQQVSLAYG------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLSVVIKPK
2b4gB           -------TTRTYLQKVSEAYGLPFGVKMPPYFDIAHFDMAAAVLNDFPLVKFITCVNSIGNGLVIVIKPK
3c61A           RQCLTAVSEVYP---------HSFGVKMPPYFDFAHFDAAAEILNEFPQVQFITCINSIGETESVVIKPK
3c3nA           -----AMRTYLQQVSLAYG--LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIVIKPK
2djlA           MRTYL--QQVSLAYG------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLSVVIKPK
2e77B           QKISPRDIEEIAGHSG-----LPVFVKGIQHPEDAD------MAIKRGASGIWVSNHG------------
2b4gA           RTYLQKVSEAYGLPFGV---------KMPPYFDIAHFDMAAAVLNDFPLVKFITCVNSIGNNETVVIKPK
2e68A           RTYLQQVSLAYG---------LPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIVIKPK
2a4aA           --TQSVKKLL-------TNKILKVIIEVGELKTEDLIIKTTLAVLNGNADFIKTSTGKVQIN--------
2e77C           ---------------------LPVFVKGIQHPEDAD------MAIKRGASGIWVSNHGAR----------
3bllA           RWAKRSRDAFDSRKE--QAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLSEG----------
2e77A           KISPRDIEEIAGHSG------LPVFVKGIQHPE------DADMAIKRGASGIWVSNHGA-----------
1bwlA           NRA--RFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVH
1bwkA           ENRARFTLEVVDALVEAIGHEKVGLRLSPYGNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVE
2du2A           KQKISPRDIEEIAGHSG----LPVFVKGIQHPEDAD------MAIKRGASGIWVSNHGA-----------
3c5xA           DIVL------------EHGSCVTTMAKNKPTLDFKTEAKQPATLRKYCIEAKLTNTTTESRCP-------
1al8A           ---------LKNFEGIDLGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGI
3c6eA           DIVL------------EHGSCVTTMAKNKPTLDFKTEAKQPATLRKYCIEAKLTNTTTESRCPTQGEPSL
2bbfA           ERSMRWAKRSRDDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGL-------------
2bwgD           -----------------VRAKFPEHTIMAGNVVTGE---MVEELILSGADIIKVGVGPGSV---------
2a7nA           QMDASFNWEALRWLRDLWP--HKLLVKGLLSAEDAD------RCIAEGADGVILSNHGGR----------
2a4aB           -----------TQSVKKLLTNKILKVIIEVGELKTED-LIIKTTLAVLNGNADFIKTSTG--------KV
2ekcA           MTYYNPIFRIGLEKFCRLSREKGIDGFIVPDLPPEEAEELKAVMKKYVLSVPLGAPTSTRKRIKLICEAA
1ea0A           ----------------------------------------------------------------------
2c6qB           LEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGN--VVTGEMVEELILSGADIIKVGIGPGS
1al7A           LPP---FLTLKNFEGIDLGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGI
3b5vA           PILMADFIVKESQIDDAYNLGADTVALIVAILTEAELESLLAYARSYGMEPLIKINDENDLDIALRIGAR
2dztB           ----------------AEAKASGVAGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
2bwgA           -----------------VRAKFPEHTIMAGNVVTGEMVE---ELILSGADIIKVGVGP----------GS
2dzuB           ----------------AEAKASGVNGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
1b3oA           ---------------------VDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDA
2dzxB           ----------------AEAKASGVDGILVVDLPVFHAKEFTEIARAAGIKTVFLAAPNTPDERLKVIDDM
2a7rA           LEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGN--VVTGEMVEELILSGADIIKVGIGPGS
2dzpB           -----------------------VDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
1a0dA           DNLARFLHMAVDYAKEIGFDGQFLPKEPTKHQYDFDVATALAFLQTYGLKDYFKFNIEANHATLAGHTFE
3ct7A           PLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHK
2bleA           ------------------RAKFPEHTIMAGNVTGEMVEELILSGADIIKVGVG--------------PGS
3dz1A           ---------------------APTPFHDDGKIDDVSIDRLTDFYAEVGCEGVTVLGIL------------
1a53A           PILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIEINDENDLDIALRIGAR
1ak5A           -------DFRERVPALVEAGADVLCIDSSDGFSEWQKITIGWIREKYGDKVKVGAGNIVDGEGFRYLADA
1dbtB           TPAG--KKRPSLIAVTQLTSTSEQIMKDELLIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAIYQAVS
2c3zA           PILMKDFIVKESQIDDAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIEINDENDLDIALRIGAR
2dzwB           ------------------------DGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
2a7rC           LEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVT--GEMVEELILSGADIIKVGIGPGS
2e09B           ---------------------------LVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
2bwgB           -----------------VRAKFPEHTIMAGNVVTGE---MVEELILSGADIIKVGV----------GPGS
2dzvA           ---------------------------LVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPAERLKVIDDM
2dzpA           --------------------------------PVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
1efzA           ERSMRWAKRSRDDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLA------------
1dvjC           FGCRIIADFKVADIPETNEKICRATFKAPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEI
1dxiA           DRMKEAFDLLGEYVTAQGYDLRFAIEPKPNEPRGDILLPTVGHALA------------------------
2dzsA           RALKNGFKLREAFWIVKEFRSTPIVLMTYYNPIYAGVRNFLAAAKASGVDGILVVDLPVFHAKEFTEIAR
2dzsB           ---------------------------LVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
3cu2A           VTLQLEQYHDFALTIEWLAKQKTTYANQVYPVLIGACLCPETPISELEPYLDQI-------DVIQLLTLD
2dzuA           ---------------------------LVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
2dzvB           ----------------------------------------------------------------------
2cu0B           -----------------------------NLKAIKSMKEMRQKVDADFIVGNIANPKAVDDLTADAVKVG
2a7rD           --------------------------------------------VVTGEMVEELILSGADIIKVGIGPGS
2a1yA           ------------NMIQHIKKHLPESFVIAGNVGTPE---AVRELENAGADATKVGIGPGKVCITKI----
2e09A           ---------------------------LVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVDDMT
2cffA           ---------------------LKSLREIDVEPVFSLVTRGGRVAFKGWLAEEEIDPVSLLKRLKEYGLEI
2dzwA           ------------NFLAEAKASGVDGILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMT
2cu0A           -----------------------------NLKAIKSMKEMRQKVDADFIVGNIANPKAVDDLTADAVKVG
2bznA           --------------------------------------------VVTGEMVEELILSGADIIKVGIGPGS
2dzxA           ----------------------------------------------------------------------
2c6qA           ------------EAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADI
2a7rB           LEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGN--VVTGEMVEELILSGADIIKVGIGPGS
1b3oB           ---------------------------------------QAKNLIDAGVDALRVGMGSGSICITQEVLAC
1dvjA           FGCRIIADFKVADIPETNEKICRATFKAGADAGADSVRACLNVAEEMGREVFLLTEMSHPQGAADEIARM
2dztA           ----------------------------------------------------------------------
3c2zA           -----SRDAFDS--RKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAV----------------
2c6qG           --------------------------------------------VVTGEMVEELILSGADIIKVGIGPGS
1eepA           -----------------------LVIDSAHGHSTRIIELIKKIKTKYPNLDLIAGNIVTKEAAVGIGPGS
2bznD           EHFVEFVKDV--------RKRFPQHTIMAGNVVTGE---MVEELILSGADIIKVGIGP----------GS
1chrA           -----------------HNRFKVKLGFRSPQDDLIHMEALSNSLGSKAYLRVDVNQAWDEQVASVYIPEL
2btmA           -------------MFAETDETVNKKVLAAFTRGLIPIICCGESLEEKALAGLTPEQVKQAVIAYEPIWAI
1dbtA           TPAG---KKRPSLIAVTQLTSTSEQIMKDELLIEKSLIDTVVHYSKQAEESGLDGVVCSVHEAKAI----
2bznB           ------------------RKRFPQHTIMAGNVVTGE---MVEELILSGADIIKVGIGPGS-----VCTTR
2dw7A           ----------------------------PIEEDRMRIEAVLEEIGKDAQLAVDANGRFNLETGIAYAKML
1btmA           ----------------------------------------------------------------------
1dvjB           -----------------------ADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGA
2ekcB           -----------------------------PDLPPEEAEELKAVMKKYVLSFVPLGAPTSTRKRIKLICEA
3dwjA           TGTYQLTLDELIFATKMAHRNAPRCIGRI-QWSNLQVFDARNCSTAQEMFQHICRHI---LYATNNGNIR
2ashA           -----TYRWALRSKKAFKTENQALFGIVQGGIYPDLRRESALQLTSIGFDGYAI----------------
3e7mA           ETTGTYQLTLDELI-----FATKMAWRNAPR-----CIGRIQWSNLQVFDARNCSTAMFQHICRHILYAT
3e7sA           STGTYHLRESELVFGAKQAWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYA-----TNRGN
1eepB           ---------------------LDLIAGNIVTKEA------ALDLISVGADCLKVGIGPGSICTTRIVAGV
3e7gA           ------VEAVTKEIETTGTYQLTGDELIFAT--KQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHI
3bggA           -----------EGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRA
2aqwA           TINVYGTNLKDICFDYEKNKYYSAYVLIKTTNKDSFIFQNELSINDKQAYIVADETQKATELKIEQNNEF
3egbB           IDFV---------VTDTQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGE----------KA
3c0jA           ------------------IVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTG---ESATLNHD
1ad1B           ------------------------------------------------MGILNVTPN--VESAVTRVKAM


                         .         *         .         .         .         .         +:350
query           EEAGGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVR
1d3hA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVG
1d3gA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVG
3bicB           VHAVGVSTLGHKTLVPELIKELNSLGRPDILVM-CGGVIPPQDYEFLFEVGV---SNVFGPGTRIPKAAV
1djnA           GEDAGPSRFYQQGHTIPWVKLVKQVSK--KPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQ
1djqA           FYQQGHTIPWVKLVKQVS----------KKPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQ
2djxA           QGFGGLGGKYILPTALANVNAFYRRCPD-KLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
2e68B           QGFGGLGGKYILPTALANVNAFYR-RCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
2b4gB           QGFGGLGGKYVLPTALANVNAFFRRCPD-KLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFA
3c61A           QGFGGLGGRYVLPTALANVNAFYRRCPG-KLIFGCGGVYTGEDAFLHVLAGASMVQVGTALHEEGPAIFE
3c3nA           QGFGGLGGKYILPTALANVNAFYRRCPD-KLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
2djlA           QGFGGLGGKYILPTALANVNAFYR-RCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
2e77B           --ARQLYEAP---GSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLF-------
2b4gA           QGFGGLGGKYVLPTALANVNAFFRRCPD-KLVFGCGGVYSGEEAFLHILAGASMVQVGTALHDEGPIIFA
2e68A           QGFGGLGGKYILPTALANVNAFYRRCPD-KLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFT
2a4aA           ---ATPSSVEYIIKAIKEYIKNNPEKNNKIGLKVSGGISDLNTASHYILLARRFLSDNFRIG--SSSLVI
2e77C           -------QLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLF-------
3bllA           -----------QDEMFRVLDFSVPMLPD-DKPHYLMGVGKPDDIVGAVERGIDMFDCGQAFTW-------
2e77A           ------RQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLF-------
1bwlA           LVEPRVTNPFLTEGEGEYEGGSNDFVYSIGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVD
1bwkA           PRVTNPFLTEGEGEYEGSNDFVYSIWK--GPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVD
2du2A           ------RQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGEHVAKALASGADVVALGRPVLF-------
3c5xA           -TQGEPSLNEEQDKRFVCKHSMDRGWGNGCGLFGKGGIVTCAMFRCKKNMEGKVVQPENL-EYTIVITPH
1al8A           VSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVF-------
3c6eA           NEEQDKRF-------VCKHSMVDRGWGNGCGLFGKGGIVTCAMFRCKKNMEGKVVQPENLE-YTIVITPH
2bbfA           ------AVGEGQDEMFRVLDFSVPMLPDDKPHY-LMGVGKPDDIVGAVERGIDMFDCVLPTRSNGQAFTW
2bwgD           -CTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSG-------
2a7nA           -------QLDCAISPMEVLAQSVAKTG--KPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGE
2a4aB           QINATPSSVEYIIKAIKEYIKNNPEKNNKIGLKVSGGISDLNTASHYILLARFLFRIGSSSLV--IKLRK
2ekcA           DEMTYFVSVTGYERIKKKVEEYRELCD--KPVVVGFGVSKKEHARE-IGSFADGVVVGSALVKLKIEDLG
1ea0A           ----------------------------------------------------------------------
2c6qB           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSE----
1al7A           IVSNHGAQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGE
3b5vA           FIGIVSADWETLAINKANQAKLISMIPSNVVKVAAFGISARNEIAELRALGVNAFSIHSS-LMRNPEKIK
2dztB           TTGFYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2bwgA           VCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGE
2dzuB           TVSLYGTTEEIPKTAYDLLRRAKRICRN--KVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
1b3oA           GVDALRVGMGSRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAAT-TEAPG
2dzxB           TVSLYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2a7rA           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2dzpB           LVSLYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
1a0dA           HELRVARIH-------------------------------------------------------------
3ct7A           ADKITVMTVDPGFAGQPFIPEMLDKLAELEYEIEVDGSCNQATYEKLMAAGADVFIVGTSGLFNHAENID
2bleA           VCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGE
3dz1A           ----GEAPKLDAAEAEAVATRFIKRAKSQVIVGVSAPGFAARRLARLSDAGAAGVIAPPPSLRTDEQITT
1a53A           FIGINSRDLETLEINKENQRKLISMIPSNVVKVAESGISERNEIEELRKLGVNAFLIGSS-LMRNPEKIK
1ak5A           GADIGRGQATAVIDVVAERNKYFEETGIYIPVCSDGGIVYDYHMTLALAMGADFIMLGRYFARFEESPTR
1dbtB           PS----------------FLTVTPGIR--MSEDAANDQVRVATPAIAREKGSSAIVVGRS-ITKAEDPVK
2c3zA           FIGINSRDLETLEINKENQRKLISMIPSNVVKVAESGISERNEIEELRKLGVNAFLIGSS-LMRNPEKIK
2dzwB           TVSLYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2a7rC           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2e09B           TVSLYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2bwgB           VCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSG-------
2dzvA           TTGFLYGTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2dzpA           TTGSLYGTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
1efzA           -------VGEGQDEMFRVLDFSVPMLPDDKPHYL-MGVGKPDDIVGAVERGIDMFDCVLPTRSGGQAFTW
1dvjC           ARMGVDLGVVGPSTRPERLSRLREIIGQD-SFLISPGVGAQGGDPGETLRFADAIIVGRSIYL-------
1dxiA           ----------------------------------------------------------------------
2dzsA           EEGIKTVFLAAPNTPDERLKVIDDMTTGFNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2dzsB           TTGLYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
3cu2A           PRNGTKYPSELILDRVIQVEKRLGNRRVEKLINIDGSTLELAKYFKQGTHQIDWLVSGSALFSGELKTN-
2dzuA           TTGLYGTEEIPK-TAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2dzvB           ---LYGTTEEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2cu0B           IGPGSIVAGVGVPQITAVAMVADRAQEYGLYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGK
2a7rD           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2a1yA           -KTGFGTGGWQLAALRWCAKAAS------KPIIADGGIRTNGDVAKSIRFGATMVMIGSLFAG-------
2e09A           TGFVYLVSLYGTEEIPKTAYDLLRRAKRICKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2cffA           VHTEIEKDGTLQEHDFSLTKKIAI--EAEVKVLAAGGISSENSLKTAQKVHTETNGLLKGVILEGILTVE
2dzwA           TGFVYLVSLYGTEEIPKTAYDLLRRAKRICKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2cu0A           GPGSICTTRIVAGVGVPQITAVAMVAEYGLYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGK
2bznA           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSE----
2dzxA           -------------------------------VAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
2c6qA           IKVGIGPGSVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
2a7rB           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSE----
1b3oB           GRP----------QATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAAT-TEAPG
1dvjA           GVDLGVKNYVGPSTRPERLSRLREIIGQ-DSFLISPGVGAQGGDPGETLRFADAIIVGRSIYL-------
2dztA           -----------------------------NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
3c2zA           ---GGLAVGEGQDEMFRVLDFSVPMLPDDKPHYL-MGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGFTW
2c6qG           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAG-------
1eepA           ICTTRIVAGVGVPQITAICDVYEACNNTNICIIADGGIRFSGDVVKAIAAGADSVMIGNLFAG-------
2bznD           VCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGE
1chrA           EALGVELEQPVGRENTQALRRLSDNNR--VAIMADESLSTLASAFDLARDRSVDVFSLKLCNMGGVSATQ
2btmA           GTGKSSTPEDANSVCGHIRSVVSRLFGPEIRIQYGGSVKPDNIRDFLAQQQIDGALVGGA-SLEPASFLQ
1dbtA           -------------YQAVSPSFLTVTPGIRMSEDAANDQVRVATPAIAREKGSSAIVVGRS-ITKAEDPVK
2bznB           KKTGVGYPQLSAVMECADAAH-----GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAG-------
2dw7A           RDYPLFWEEVGDPLDYALQAALAEFYP--GPMATGENLFSHQDARNLLRYGGMRPDRDWLQFSYGLCEYQ
1btmA           --------EDANSVCGHIRSVVSRLFGPEIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGA-SLEPASFLQ
1dvjB           ADEIARMGVDLGVKNYVGLSRLREIIGQ-DSFLISPGVGAQGGDPGETLRFADAIIVGRSIY--------
2ekcB           ADEMTYFVSVGYERIKKKVEEYRELCD--KPVVVGFGVSKKEHARE-IGSFADGVVVGSALVKLA-----
3dwjA           SAITV-------FPQRSDGKHDFRLWN--SQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWK-PRYGR
2ashA           ---GGLSIGEERSLTLEMTEVTVEFLPEDKPRYFMGGG-SPELILELVDRGVDMFDSVFPTRIHGTALTW
3e7mA           NNGNIRSAITVFPQRSDGKHDFRLWNS---QLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWK-PRYGR
3e7sA           LRSAITVFPQRAPG-----RGDFRIWN--SQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWT-PGNGR
1eepB           GVPQITAICDVYEACNN----------TNICIIADGGIRFSGDVVKAIAAGADSVMIGNL-FAGTKESPS
3e7gA           CRHVRYSTNNGNIRSAIDGKHDFRVWN--AQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWK-PKYGR
3bggA           AVRMAEEHGSRVSMKPEFLHLTPGVQLE--AGGDNLGQQYNSPQEVIGKRGSDIIIVGRG-IISAADRLE
2aqwA           IGFVVGSNAFEEKIIRNKFPDSYILSPG--IGAQNGDLYKTLKNGYNKDYEKLLINVGRA-ITKSPDPKK
3egbB           AKWKNPDGHMDGLTTNGVLVMHPRQPGVWREISVCGDVYTLRETRSAQQTNVLQDGSLID-LCGATLLWR
3c0jA           EHA-------------DVVMMTLDLADGRIPVIAGTGANATAETQRFNDSGIVGCLTVTPYYNR------
1ad1B           MDEGGVSTMITVEEELRVLPVVEAIVG--FDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYD------


                         .         .         .         .         *         .         .:420
query           ECASALRR
1d3hA           KVKRELEA
1d3gA           KVKRELEA
3bicB           QVLDDIEK
1djnA           KVEQGR--
1djqA           KVEQGR--
2djxA           RLEDELLE
2e68B           RLEDELLE
2b4gB           RLNKELQE
3c61A           RLTAELLD
3c3nA           RLEDELLE
2djlA           RLEDELLE
2e77B           --------
2b4gA           RLNKELQE
2e68A           RLEDELLE
2a4aA           KLRKVI--
2e77C           --------
3bllA           --------
2e77A           --------
1bwlA           RLEKGLP-
1bwkA           RLEKGLP-
2du2A           --------
3c5xA           S-------
1al8A           --------
3c6eA           S-------
2bbfA           DGPINIRN
2bwgD           --------
2a7nA           T-------
2a4aB           VIS-----
2ekcA           NLVKELK-
1ea0A           --------
2c6qB           --------
1al7A           A-------
3b5vA           E-------
2dztB           EATEFLKK
2bwgA           --------
2dzuB           EATEFLKK
1b3oA           EDKGSIHK
2dzxB           EATEFLKK
2a7rA           LIE-----
2dzpB           EATEFLKK
1a0dA           --------
3ct7A           EAWRIMTA
2bleA           VI------
3dz1A           --------
1a53A           E-------
1ak5A           KVTINGSV
1dbtB           A-------
2c3zA           E-------
2dzwB           EATEFLKK
2a7rC           LIERDGKK
2e09B           EATEFLKK
2bwgB           --------
2dzvA           EATEFLKK
2dzpA           EATEFLKK
1efzA           DGPINIRN
1dvjC           --------
1dxiA           --------
2dzsA           EATEFLKK
2dzsB           EATEFLKK
3cu2A           --------
2dzuA           EATEFLKK
2dzvB           EATEFLKK
2cu0B           EVIINGRK
2a7rD           LIE-----
2a1yA           --------
2e09A           EATEFLKK
2cffA           VMKRYAR-
2dzwA           EATEFLKK
2cu0A           EVI-----
2bznA           --------
2dzxA           EATEFLKK
2c6qA           L-------
2a7rB           --------
1b3oB           EDKGSIHK
1dvjA           --------
2dztA           EATEFLKK
3c2zA           DGPINIRN
2c6qG           --------
1eepA           --------
2bznD           L-------
1chrA           KIAAVAE-
2btmA           LVEA----
1dbtA           A-------
2bznB           --------
2dw7A           RTLEVLKT
1btmA           LVE-----
1dvjB           --------
2ekcB           --------
3dwjA           FDVLPL--
2ashA           NGKLNLK-
3e7mA           FDVLPL--
3e7sA           --------
1eepB           EEIIYNGK
3e7gA           FDVVPL--
3bggA           AAEMYRKA
2aqwA           SSESYYN-
3egbB           T-------
3c0jA           --------
1ad1B           --------