[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08451.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1drmA.bssp"
#ERROR : Can't open dsspfile "2cmnA.bssp"
#ERROR : Can't open dsspfile "2b02A.bssp"
#ERROR : Can't open dsspfile "3c2wD.bssp"
#ERROR : Can't open dsspfile "1dp8A.bssp"
#ERROR : Can't open dsspfile "1d06A.bssp"
#ERROR : Can't open dsspfile "2a24B.bssp"
#ERROR : Can't open dsspfile "3eehA.bssp"
#ERROR : Can't open dsspfile "2a24A.bssp"
#ERROR : Can't open dsspfile "3caxA.bssp"
#ERROR : Can't open dsspfile "3c2wC.bssp"
#ERROR : Can't open dsspfile "3bz1C.bssp"
#ERROR : Can't open dsspfile "3c2wH.bssp"
#ERROR : Can't open dsspfile "3b33A.bssp"
#ERROR : Can't open dsspfile "2d01A.bssp"
#ERROR : Can't open dsspfile "3c2wB.bssp"
#ERROR : Can't open dsspfile "1d7eA.bssp"
#ERROR : Can't open dsspfile "3bwlB.bssp"
#ERROR : Can't open dsspfile "3bwlA.bssp"
#ERROR : Can't open dsspfile "3c2wA.bssp"
#ERROR : Can't open dsspfile "2d02A.bssp"
#ERROR : Can't open dsspfile "3bwlC.bssp"
#ERROR : Can't open dsspfile "1bywA.bssp"
#ERROR : Can't open dsspfile "3c2wE.bssp"
#ERROR : Can't open dsspfile "3bwlD.bssp"
#ERROR : Can't open dsspfile "3c2wF.bssp"
#ERROR : Can't open dsspfile "3c2wG.bssp"
#ERROR : Can't open dsspfile "3bs2A.bssp"
#ERROR : Can't open dsspfile "3crkB.bssp"
#ERROR : Can't open dsspfile "3crlB.bssp"
#ERROR : Can't open dsspfile "2btvA.bssp"
#ERROR : Can't open dsspfile "3crlA.bssp"
#ERROR : Can't open dsspfile "2btzA.bssp"
#ERROR : Can't open dsspfile "3d72A.bssp"
#ERROR : Can't open dsspfile "2e0aB.bssp"
#ERROR : Can't open dsspfile "2e0aA.bssp"
#ERROR : Can't open dsspfile "3d2rB.bssp"

## Summary of PDB Search
:139
    3e-18  24%  1drmA  [d.110.3] SENSOR PROTEIN FIXL
    3e-18  24%  2cmnA  [x.x.x] SENSOR PROTEIN FIXL
    7e-18  13%  2b02A  [x.x.x] ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
    1e-17   9%  3c2wD  [x.x.x] BACTERIOPHYTOCHROME
    1e-17  23%  1dp8A  [d.110.3] FIXL PROTEIN
    4e-17  30%  1d06A  [d.110.3] NITROGEN FIXATION REGULATORY PROTEIN FIXL
    1e-16  17%  2a24B  [x.x.x] ARYL HYDROCARBON RECEPTOR NUCLEAR TRANSLOCATOR
    4e-16  14%  3eehA  [x.x.x] PUTATIVE LIGHT AND REDOX SENSING HISTIDINE
    1e-15  21%  2a24A  [x.x.x] ENDOTHELIAL PAS DOMAIN PROTEIN 1
    1e-15  14%  3caxA  [x.x.x] UNCHARACTERIZED PROTEIN PF0695
    3e-15  10%  3c2wC  [x.x.x] BACTERIOPHYTOCHROME
    8e-15   7%  3bz1C  [x.x.x] PHOTOSYSTEM II CP43 PROTEIN
    3e-14  10%  3c2wH  [x.x.x] BACTERIOPHYTOCHROME
    3e-14  19%  3b33A  [x.x.x] SENSOR PROTEIN
    4e-14  17%  2d01A  [x.x.x] PHOTOACTIVE YELLOW PROTEIN
    7e-14  10%  3c2wB  [x.x.x] BACTERIOPHYTOCHROME
    2e-13  19%  1d7eA  [d.110.3] PHOTOACTIVE YELLOW PROTEIN
    2e-13  19%  3bwlB  [x.x.x] SENSOR PROTEIN
    3e-13  21%  3bwlA  [x.x.x] SENSOR PROTEIN
    9e-13  10%  3c2wA  [x.x.x] BACTERIOPHYTOCHROME
    6e-12  17%  2d02A  [x.x.x] PHOTOACTIVE YELLOW PROTEIN
    6e-12  19%  3bwlC  [x.x.x] SENSOR PROTEIN
    7e-12  18%  1bywA  [d.110.3] PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
    3e-11  11%  3c2wE  [x.x.x] BACTERIOPHYTOCHROME
    6e-11  18%  3bwlD  [x.x.x] SENSOR PROTEIN
    4e-10  12%  3c2wF  [x.x.x] BACTERIOPHYTOCHROME
    1e-08   9%  3c2wG  [x.x.x] BACTERIOPHYTOCHROME
    2e-08   2%  3bs2A  [x.x.x] LIPOCALIN
    2e-08   6%  3crkB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    4e-06   9%  3crlB  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    5e-06   2%  2btvA  [e.28.1] PROTEIN (VP3 CORE PROTEIN)
    7e-06   9%  3crlA  [x.x.x] PYRUVATE DEHYDROGENASE [LIPOAMIDE] KINASE
    8e-06   9%  2btzA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOENZYME 2
    2e-05  23%  3d72A  [x.x.x] VIVID PAS PROTEIN VVD
    2e-05  10%  2e0aB  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    9e-05   8%  2e0aA  [x.x.x] PYRUVATE DEHYDROGENASE KINASE ISOZYME 4
    6e-04   8%  3d2rB  [x.x.x] [PYRUVATE DEHYDROGENASE [LIPOAMIDE]] KINASE
:139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxISTNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA
1drmA           --------------IPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
2cmnA           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISAY
2b02A           ----------NVSQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPE----DQQLLRDS
3c2wD           ---------PGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQEQVGPEVLRMLEEGLTGNG
1dp8A           ----------------DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
1d06A           ---------SILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRY
2a24B           -------------QPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIEFCHPEDQQLLRDSFQQVV
3eehA           ---------ELTEATNDILWEFTADSEVLVINSAYEDIWGRSVAKLRENPHDFLNGIHPEDRELMKDTMQ
2a24A           ----------------TFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNL
3caxA           ----------IFEALPVDVTFIDKDDRVRFFSPGERIFTRTPSVLGRPVQLCHPPKSVYVVNKILKAFKE
3c2wC           ----------GAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQEQVGPEVLRMLEEGLTGNG
3bz1C           ---------SAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGNGLDLNKIKNDIQPWQERR
3c2wH           ---------PGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQEQVGPEVLRMLEEGLTGNG
3b33A           --------PSAILNNVTATLILDDGLAIRYANPAAELLFSQSAKRIVEQSLSQLIQH--ASLDLALLTQP
2d01A           ---------GQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFKDVAPCTDSPEFYGKFKEG
3c2wB           ---------PGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQEQVGPEVLRMLEEGLTGNG
1d7eA           ---------GQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFKDVAPCTDSPEFYGKFKEG
3bwlB           -----------LFENSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIWEFDLFD-AEDVQTQLSGF
3bwlA           -----------LFENSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIWEFDLF--DAEDVQTQLSG
3c2wA           ----------GAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQEQVGPEVLRMLEEGLTGNG
2d02A           ---------GQLDGLAFGAIQLDGDGNILQYNAAEGDITGQDPKQVIGKNFKDVAPCTDSPEFYGKFKEG
3bwlC           ---------EALFENSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIWEFDLFDAEDVQT--QLSG
1bywA           ---------------SRKFIIANANCAVIYCNDGFCELCGYSRAEVMQRPC----TCDFLHGPCTQRRAA
3c2wE           ----------GAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQEQVGPEVLRMLEEGLTGNG
3bwlD           ---------EALFENSPDIDVLDADGTICEVNQRFCAELGYDESEVLGRSIWEFDLFDAEDVQTQLSGFS
3c2wF           ---------PGAIQPHGALVTLRADGMVLAASENIQALLGFVASPGSYLTQE-QVGPEVLRMLEEGLTGN
3c2wG           ----------LAHPDDGIAALIPCDGALVMLGGRTLSIRGDFERQAGNVLQRLQRDPERDIYHTDNWDCC
3bs2A           --------TASASISGNAIVVGTDHSEVLYSDGSTCDVVRLNGQIELWIHSSATSNTGNLNSCCTDKFNQ
3crkB           ------------------------------LAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTF
3crlB           ------------------------------LAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACE------
2btvA           -------SRDRVLRVDTYYEEMSQVGDVITEDEPEKFYSTIIKKVRF-----------------------
3crlA           ------------------------------LAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTF
2btzA           ---------------------------------APKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTF
3d72A           --IMNRPNPQVELGPVDALILCDLDTPIVYASEAFLYMTGYSNAEVLGQSPDGMVKPKSTRKYV--DSNT
2e0aB           -------------------------------PREVEHFSRYSPSPLSMKQL-------------------
2e0aA           -----------------------------------------------------------EVEHFSRYSPS
3d2rB           -------------------------------PREVEHFSRYSPSPLSMKQLLDFG---------------


                         .         .         *         .         .         .         .:140
query           IDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVTDKVERERAQSAAxxxxx
1drmA           RTTSDPHIIGIGRIVTGKRRDGT--TFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQAR---------
2cmnA           RTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQS--GGEPYFTGFVRDLTEHQQTQAR---------
2b02A           FQQVVKLKGQVLSVFRFRSKNQEWLWRTSSFTFQNPYSDEIEYIICTNTNV------------------
3c2wD           PWSNSVET-------RIGEHLFDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIAQ---------
1dp8A           RTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQS--GGEPYFTGFVRDLTEHQQTQAR---------
1d06A           MATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRS--GGERFFTGFIRDLT-----------------
2a24B           KLKGQVL----SVMFRFRSKNQEWLWMRTSSFTFQNPSDEIEYIICTNTNV------------------
3eehA           SLMDGESADVECRV---NATEEYQRWVWIQGEPITNDAGETVRVAGFARDIT-----------------
2a24A           CTKGQVV----SGQYRMLAKHGGYVWLETQGTVIYNPRNLQPCIMCVNYVLS---EIE-----------
3caxA           GRKKEAT----------FWLRLREKYVYIKYVPLFNEKGEYIGTLEMTMDIAPYKKIEGE---------
3c2wC           PWSNSVE-------TRIGEHLFDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRII-----------
3bz1C           AAEYMTHAPLGSSVGGVATEINSVNFVSPRSWLATSHFVLAFF--FLVGHLWH-AGRARAAAA------
3c2wH           PWSNSVE-------TRIGEHLFDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIAQV--------
3b33A           LQSGQSI-----TDSDVTFVVDGRPLLEVTVSPITWQRQLLL----VERKI------------------
2d01A           VASGNLNTMF----EYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV----------------------
3c2wB           PWSNSVE-------TRIGEHLFDVIGHSYKEVFYLEFEIRTADTLSITSFTLNAQRIIAQV--------
1d7eA           VASGNLN----TMFEYTFDYQMTPTKVKVH---MKKALSYWVFVKRV----------------------
3bwlB           SVDERRKFE-----GLYERRDGS-TSVEVHLLRFNLEGEDRF--LAISRDI------------------
3bwlA           FSVDERR----KFEGLYERRDGS-TSVEVHLLRFNLEGEDRF--LAISRDI------------------
3c2wA           PWSNSVET---------RIGEHLFDVIGHSYKEVFYLEFEIRTADTLSIT-------------------
2d02A           VASGNLN----TMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV----------------------
3bwlC           FSVDERR----KFEGLYERRDGS-TSVEVHLLRFNLEGEDRF--LAISRDI------------------
1bywA           AQIAQALLGAEEVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK---------------
3c2wE           PWSNSVETRIG---EHLFDVIGHSYKEVFYLEFEIRTALSITSFTLNAQRIIAQVQLHN----------
3bwlD           VDERRKF------EGLYERRDGSTSVE---VHLLRFNLEGEDRFLAISRDI------------------
3c2wF           GPWSNS---------------------------------------------------------------
3c2wG           GVLAI-RFH---------RQESGWIFWF------RHEEVHRIRWGGKPEKLLTIGPSGPR---------
3bs2A           EKGSRPE----HVVYRSTCPNLP----------------------------------------------
3crkB           LRQELPV-----------RLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPED-----
3crlB           ---------------------------------------------------------------------
2btvA           ---------------------------------------------------------------------
3crlA           LRQELPV--------------------------------------------------------------
2btzA           LRQELPV--------------------------------------------------------------
3d72A           INTMRKAIDRNAEVQVEVKKNGQRFVNFLTMIPVRDETGEYRYSMGF----------------------
2e0aB           LDFGSC-----ERTSFAFLRQELPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEF-----
2e0aA           PLSMKQLLDFGSCERTAFLRQELPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMD---------
3d2rB           ------SENACERTSFAFLRQELPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMD---------