[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08536.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cuqB.bssp"
#ERROR : Can't open dsspfile "3bhkA.bssp"
#ERROR : Can't open dsspfile "3c96A.bssp"
#ERROR : Can't open dsspfile "2e4gB.bssp"
#ERROR : Can't open dsspfile "3dmeA.bssp"
#ERROR : Can't open dsspfile "1bkwA.bssp"
#ERROR : Can't open dsspfile "1bgjA.bssp"
#ERROR : Can't open dsspfile "3cgvA.bssp"
#ERROR : Can't open dsspfile "1cj2A.bssp"
#ERROR : Can't open dsspfile "3e1tA.bssp"
#ERROR : Can't open dsspfile "1b3mA.bssp"
#ERROR : Can't open dsspfile "1bf3A.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "1an9A.bssp"

## Summary of PDB Search
:404
    2e-07   8%  3cuqB  [x.x.x] VACUOLAR PROTEIN-SORTING-ASSOCIATED PROTEIN 36
    3e-07  13%  3bhkA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    3e-07  19%  3c96A  [x.x.x] FLAVIN-CONTAINING MONOOXYGENASE
    2e-06  11%  2e4gB  [x.x.x] TRYPTOPHAN HALOGENASE
    3e-06  16%  3dmeA  [x.x.x] CONSERVED EXPORTED PROTEIN
    2e-05  22%  1bkwA  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  22%  1bgjA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-04  23%  3cgvA  [x.x.x] GERANYLGERANYL REDUCTASE RELATED PROTEIN
    1e-04  22%  1cj2A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-04  21%  3e1tA  [x.x.x] HALOGENASE
    2e-04  13%  1b3mA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    4e-04  26%  1bf3A  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    4e-04  12%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    6e-04  13%  1an9A  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
:404

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3cuqB           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
3c96A           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
3dmeA           ----------------------------------------------------------------------
1bkwA           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGYYFLTTDTPNLM
3cuqB           ----------------------------------------------------------------------
3bhkA           ---------------------------------------------------------------------I
3c96A           ---------------------------------------------------------AYPQYSIHRGELQ
2e4gB           ----------------------------------------------------------------------
3dmeA           ----------------------------------------------------------------DSHALM
1bkwA           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b3mA           --------------------------------------------------------------------CI
1bf3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RWLASELVNHGVDLRLGTSFSQASRSGAGWSVPGVGRTRYLVGADGARSRVAQIAGLGQGNAFLYGVEYE
3cuqB           ----------------------------------------------------------------------
3bhkA           RAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANGSDKLIVSMGAWNSLLSKLNLDIPLQPYRQVVGF
3c96A           MILLAAVRERLQAVRTGLGVERIEERDGRVLIPQALGADVLVGADGIHSAVRAHLHPDQRPLSMWRGVTE
2e4gB           ------------------------------------DADLFVDCSGFRGLLINKAMEE----PFLDMSDH
3dmeA           LAYQGDAESDGAQLVFHTPLIAGRVRPEGGFEPMTLSCRVLINAAGLHAGLARRIEGIPRDSIPPEYLCK
1bkwA           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1b3mA           RAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANTADKLIVSMGAWNSLLSKLNLDIPQLPYRQVVGF
1bf3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FAGLQLSDPDALHCFASKHFAPGYIGWVAQNPTGVQAGXXXXXXXXXXXXXDIDGFLRRVRHLLGVPEDA
3cuqB           ----------------------------------------------------ISEAFEDLSKLMIK----
3bhkA           FESDESKYSNDIDFPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGDESNLRAFLEEY
3c96A           FDRFLDGKTMIVANDEHWSRLVAYPISARHAAEGKSAVGQLDNEADWNRDGRLEDVLPFFADWDLGWFDI
2e4gB           LLNDSAVATQVPHDDDANGVEPFTSAIAMKSGWTWKIPMLGRFGTGYVYSSRFATEDEAVREFCEMWHLD
3dmeA           GSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDG
1bkwA           ------------------------------------------------------------PAEVAEKLVT
1bgjA           -------------------------------------------------------LKARLPAEVAEKLVT
3cgvA           ----------------------------------------------------------------------
1cj2A           -------------------------------------------------------LKARLPAEVAEKLVT
3e1tA           ----------------------------------------------------------------------
1b3mA           FESDESKYSNDIDFPGFMVEVPNGIYYGFPSFGGCGYHTFGQKIDPDTINREFGVYPEDESNLRAFLEEY
1bf3A           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
1an9A           -------------------------------------------------------IWEGCCRLEPTLKDA


                         .         *         .         .         .         .         +:350
query           APTTTRAGLIPCGGPVYPLARDGVLLTGDAAGIVSPVTAGGIHAAWRHGEAVGRAIAAHLRTGAATPEQV
3cuqB           AKEMVELSKSIANKDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLT
3bhkA           MPGANGELKRGAVCM-YTKTLDEHFIIDLHPEHSNVVIAAGFSGGFKFSSGVGEVLSQLA-LTGKTEHDI
3c96A           RDLLTRNQLIVDRDPLPHWGRGRITLLGDAAHLMYPMGANGASQAILDGIELAAALARNADVAAALRE--
2e4gB           PETQPLNRIRFRVGRNRRAWVGNCVSIGTSSCFVEPLESTGIYFVYAALYQLVKHFPDKSLNPVLTARFN
3dmeA           ALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGISPGLTASLAIAEETLARL----------
1bkwA           GPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGELLE-
1bgjA           GPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREG-------
3cgvA           ----------------KVKPITPGLLVGDAARLIDPITGGGIANAIVSGYAAQVTKEAIESNDYSPQQKY
1cj2A           GPSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREG-------
3e1tA           --------------CNTSFWKNGMALVGDAACFVDPVFSSGVHLATYSALLVARAINTCLAGEMSEQRCF
1b3mA           MPGANGELKRGAVCM-YTKTLDEHFIIDLHPEHSNVVIAAGFSGGFKFSSGVGEVLSQLALTGK-TEHDI
1bf3A           -----------RSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREG-------
2e4gA           --------------------VGNCVSIGTSSCFVEPLESTGIYFVYAALYQLVKHFPDKSLNPVLTARFN
1an9A           KIVGEYTGFRPVRPQVRLREQLRFGSSNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVL----------


                         .         .         .         .         *         .         .:420
query           AEQSAPRFRTKRLLRWAFDHFQSDWAFDVLLHSAPLRWVAERIYFHKRGVAxxx
3cuqB           RARGMELLSPEDLVNACKMLEALKLPLRLRVFDS-GVMVIELQSHKEEEMV---
3bhkA           SIFSINRPALKESLQ---------------------------------------
3c96A           ------------------------------------------------------
2e4gB           REIETMFDDTRDFIQAHFYFSPTDTPFWRANKELRLAD----------------
3dmeA           ------------------------------------------------------
1bkwA           ------RYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRI-----------
1bgjA           RGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRI-----------
3cgvA           EKLIKERFELSDDTLDKLVDIVSEQVLTTISVEAILKAIAEK------------
1cj2A           RGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRI-----------
3e1tA           EEFERRYRREYGNFYQFLVAFYDMNQDTDSYFWSARKII---------------
1b3mA           SIFSINRPALKESLQ---------------------------------------
1bf3A           RGELLERYSAICLRRIWKAERFSWWMTSVLHRFPDTDAFSQRI-----------
2e4gA           REIETMFDDTRDFIQAHFYFSPRTD-----------------------------
1an9A           ------------------------------------------------------