[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08608.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2c9eA.bssp"

## Summary of PDB Search
:405
    7e-32   6%  2c9eA  [x.x.x] PERIDININ-CHLOROPHYLL A PROTEIN
:405

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c9eA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRALRPDIIYCSVTGFGPDGPYA
2c9eA           -------------AIADASKRFSDATYPIAEKFDWGGSSAIAKYIADASAGNPRQAALAVEKLLEVGLTM


                         +         .         .         .         .         *         .:210
query           PRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDILTGLYASVALMGALYHRQxxxxxxxxxxxx
2c9eA           DPKLVRAAVEAHSKALDSAKKNAKL----MASKEDFAAVNEALARMIASADKQKFAAL------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c9eA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c9eA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2c9eA           -------------------------------------------------------