[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08678.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1biaA.bssp"
#ERROR : Can't open dsspfile "1bibA.bssp"
#ERROR : Can't open dsspfile "3bp8A.bssp"
#ERROR : Can't open dsspfile "2d1hB.bssp"
#ERROR : Can't open dsspfile "2cfxA.bssp"
#ERROR : Can't open dsspfile "2dbbA.bssp"
#ERROR : Can't open dsspfile "2cweA.bssp"
#ERROR : Can't open dsspfile "3cuoC.bssp"
#ERROR : Can't open dsspfile "3bp8B.bssp"
#ERROR : Can't open dsspfile "3cuoD.bssp"
#ERROR : Can't open dsspfile "2dk5A.bssp"
#ERROR : Can't open dsspfile "2dbbB.bssp"
#ERROR : Can't open dsspfile "3cuoA.bssp"
#ERROR : Can't open dsspfile "2d1hA.bssp"
#ERROR : Can't open dsspfile "2efqA.bssp"
#ERROR : Can't open dsspfile "2efoA.bssp"
#ERROR : Can't open dsspfile "2cg4A.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "2co5A.bssp"
#ERROR : Can't open dsspfile "2e7wA.bssp"
#ERROR : Can't open dsspfile "2acjD.bssp"
#ERROR : Can't open dsspfile "2eb7A.bssp"
#ERROR : Can't open dsspfile "2a61A.bssp"
#ERROR : Can't open dsspfile "2efnA.bssp"
#ERROR : Can't open dsspfile "3boqA.bssp"
#ERROR : Can't open dsspfile "2co5B.bssp"
#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "2a61B.bssp"
#ERROR : Can't open dsspfile "3df8A.bssp"
#ERROR : Can't open dsspfile "2acjA.bssp"
#ERROR : Can't open dsspfile "1b1bA.bssp"
#ERROR : Can't open dsspfile "3cjnA.bssp"
#ERROR : Can't open dsspfile "2b0lB.bssp"
#ERROR : Can't open dsspfile "3bddD.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "3boqB.bssp"
#ERROR : Can't open dsspfile "2dlbA.bssp"
#ERROR : Can't open dsspfile "2acjB.bssp"
#ERROR : Can't open dsspfile "2e1cA.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "2cyyA.bssp"
#ERROR : Can't open dsspfile "1bg3A.bssp"
#ERROR : Can't open dsspfile "3by6C.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "2d45B.bssp"
#ERROR : Can't open dsspfile "2d45A.bssp"
#ERROR : Can't open dsspfile "3bddA.bssp"
#ERROR : Can't open dsspfile "1dtr-.bssp"
#ERROR : Can't open dsspfile "1dprA.bssp"

## Summary of PDB Search
:121
    5e-14  18%  1biaA  [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
    2e-13  19%  1bibA  [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
    4e-10  21%  3bp8A  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    8e-10  20%  2d1hB  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-09  20%  2cfxA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR LRPC
    4e-09  13%  2dbbA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    5e-09  15%  2cweA  [x.x.x] HYPOTHETICAL TRANSCRIPTION REGULATOR PROTEIN,
    2e-08  22%  3cuoC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    3e-08  14%  3bp8B  [x.x.x] PUTATIVE NAGC-LIKE TRANSCRIPTIONAL REGULATOR
    3e-08  22%  3cuoD  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    4e-08  11%  2dk5A  [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
    4e-08  14%  2dbbB  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    5e-08  22%  3cuoA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-07  21%  2d1hA  [x.x.x] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-07  14%  2efqA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    3e-07  19%  2efoA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    4e-07  18%  2cg4A  [x.x.x] REGULATORY PROTEIN ASNC
    4e-07  17%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    5e-07  16%  2co5A  [x.x.x] VIRAL PROTEIN F93
    5e-07  19%  2e7wA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    6e-07  17%  2acjD  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    1e-06  21%  2eb7A  [x.x.x] 146AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    1e-06  21%  2a61A  [x.x.x] TRANSCRIPTIONAL REGULATOR TM0710
    1e-06  19%  2efnA  [x.x.x] 150AA LONG HYPOTHETICAL TRANSCRIPTIONAL
    2e-06  12%  3boqA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    4e-06  12%  2co5B  [x.x.x] VIRAL PROTEIN F93
    1e-05  19%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    1e-05  21%  2a61B  [x.x.x] TRANSCRIPTIONAL REGULATOR TM0710
    2e-05   7%  3df8A  [x.x.x] POSSIBLE HXLR FAMILY TRANSCRIPTIONAL FACTOR
    2e-05  17%  2acjA  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    4e-05  15%  1b1bA  [a.4.5 - a.76.1] PROTEIN (IRON DEPENDENT REGULATOR)
    5e-05  19%  3cjnA  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    6e-05  14%  2b0lB  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-04  21%  3bddD  [x.x.x] REGULATORY PROTEIN MARR
    1e-04  19%  1dpuA  [a.4.5] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    1e-04  12%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    1e-04  12%  3boqB  [x.x.x] TRANSCRIPTIONAL REGULATOR, MARR FAMILY
    2e-04  17%  2dlbA  [x.x.x] YOPT
    2e-04  21%  2acjB  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    2e-04   9%  2e1cA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    3e-04  13%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-04  12%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-04  13%  2cyyA  [x.x.x] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR
    4e-04  15%  1bg3A  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE
    4e-04  19%  3by6C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    5e-04   7%  1aoyA  [x.x.x] ARGININE REPRESSOR
    6e-04   6%  2d45B  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    7e-04   7%  2d45A  [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    8e-04  24%  3bddA  [x.x.x] REGULATORY PROTEIN MARR
    9e-04  16%  1dtr-  [x.x.x] DIPHTHERIA TOXIN REPRESSOR
    0.001  18%  1dprA  [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLNYSDPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVG
1biaA           -----------------KDNTVPLKLIALLANGFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPG
1bibA           -------------------NTVPLKLIALLANGFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPG
3bp8A           ----------------QIKQTNAGAVYRLIDQGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVG
2d1hB           -------KKDEIRCCYKITDTDVAVLLKVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKYY
2cfxA           -----------------KLDQIDLNIIEELKKSRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLE
2dbbA           -------------------DRVDMQLVKILSESRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTII
2cweA           ----------DPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE
3cuoC           ------------ALLKAMSHPKRLLILCMLSGPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDA
3bp8B           -----------------IKQTNAGAVYRLIDQGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELVGL
3cuoD           ------------ALLKAMSHPKRLLILCMLSGPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDA
2dk5A           ----SSGDSQNAGKMKGSDNQEKLQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVK--
2dbbB           -------------------DRVDMQLVKILSESRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTII
3cuoA           ------------ALLKAMSHPKRLLILCMLSGPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDA
2d1hA           -------KKDEIRCCYKITDTDVAVLLKVEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVKTPKYY
2efqA           -------------------DEIDLRILKILQYAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAY
2efoA           -------------------DEIDLRILKILQYAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAY
2cg4A           -------------------DNLDRGILEALMGARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARID
2b0lA           ---------AISSLSYSELEAIEHIFEELDGNGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLG
2co5A           -------------------RINYYIILKVLVIKRLRSEILRFDIDISDGVLYPLIDSLIDDKILREEEAP
2e7wA           -------------------DEIDLRILKILQYAKYSLDEIAREIRIPKSTLSYRIKKLEKDGVIKGYYAY
2acjD           -------------------EQRILKFLEELGEGATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGT
2eb7A           ---------------------LDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVRDREDR
2a61A           -------------------TPAQFDILQKIYFGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDR
2efnA           -------------------DEIDLRILKILQYAKYSLDEIAREIRIPKATLSYRIKKLEKDGVIKGYYAY
3boqA           -------------------SLAKFDAAQLARNPDGLSGKLSGALKVTNGNVSGLVNRLIKDGVVKAFSA-
2co5B           ---------------------YIILKVLVINGSRRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAP
2acjC           -------------------------FLEELGEGATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGT
2a61B           -------------------TPAQFDILQKIYFGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRT-PD
3df8A           ----------SESVLHLLGKKYTLIISVLGNGSTNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQ
2acjA           --------------------------MEQRILKFTTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEA--
1b1bA           --------------LVDTTEMYLRTIYDLEEEGTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDR
3cjnA           ---------ANLRKETALGLSTAKRALAILSADGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDD
2b0lB           HMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLVASKIADRVGITRSVIVNALRKLESAGVIESRSLG
3bddD           ----------------------YSILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKV--
1dpuA           ---------------------AQNQVLNLIKAEGLNFQDLKNQLKMSVSSIKQAVDFLSNEGHITVDDDH
2ek5A           --------------YKQIASLIEDSIVDGTLSRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKVSA
3boqB           -------------------SLAKFDAAQLARNPDGLSGKLSGALKVTNGNVSGLVNRLIKDGVVKASF--
2dlbA           -------------------------YLNNIALLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKAD
2acjB           -------------------------FLEELGEGATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKE---
2e1cA           ------------------------------NDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAI
2ek5C           --------------YKQIASLIEDSIVDGTLSRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGI
2du9A           --------------YKQIASLIEDSIVDGTLSRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKVSA
2cyyA           -------------------DEIDKKIIKILQNGKAPLREISKITGLAESTIHERIRKLRESGVIK-----
1bg3A           -----------------IAAQLLAYYFTELKDQVKKIDKYLYAMRLSDEILIDILTKEMKNGLSR-----
3by6C           --------------YLQLVDRIKNEVATVLSANLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGK
1aoyA           -----------------KQEELVKAFKALLKEEKFAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEM
2d45B           ---------------KTYEISSAEWEVNIIWKSANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDN
2d45A           --------------------------------SANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDN
3bddA           -----------------------SILQTLLKDAPLHQLALQERLQIDRAAVTRHLKLLEESGYIIRKRNP
1dtr-           ----------------------------------PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR
1dprA           -----------------TTEMYLRTIYELEEEGVTLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR


                         .         .         *         .         .         .         .:140
query           RVRTCTMAPKALSEAEQWINARRAEWEGHFDRLGEYLETMKKEAASxxxxx
1biaA           KGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTN---------------
1bibA           KGYSLPEPIQLLNAKQILGQLDGGSVAVLPVI-------------------
3bp8A           LV-------------------------------------------------
2d1hB           YSISSNILEKIRNDLLNCAKRELA---------------------------
2cfxA           VDQKKLGLPVSCIVEATVKNADYERFKSYIQTL------------------
2dbbA           PDIDKLGYMYAIVLIKSKVPSDADKVISEISDIEY----------------
2cweA           MKGNLVEKYYGRTAVFYINLYLGDEELRYIARSRLKTKI------------
3cuoC           QRILYSIKNEAVNAIIATLKN------------------------------
3bp8B           VVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELAL-----------
3cuoD           QRILYSIKNEAVNAIIATLKN------------------------------
2dk5A           ---------------------------------------------------
2dbbB           PDIDKLGYMYAIVLIKSKVPSDADKVI------------------------
3cuoA           QRILYSIKNEAVNAIIATLKN------------------------------
2d1hA           YSISSNILEKIRNDLLNCAKRELA---------------------------
2efqA           INPASLNLDYIVITSVKAKYGKNYHVELGN---------------------
2efoA           INP------------------------------------------------
2cg4A           VSPKQLGYD------------------------------------------
2b0lA           MKGT-----------------------------------------------
2co5A           DGKVLFLTEKGMKEFEE----------------------------------
2e7wA           INP------------------------------------------------
2acjD           PPL------------------------------------------------
2eb7A           RKILIEITEKGLETFNKGIEIYKKLANEVTGDLSE----------------
2a61A           RAYFLVITRKGEEVIEKVIERRENFIEKITSDLGK----------------
2efnA           INP------------------------------------------------
3boqA           ---------------------------------------------------
2co5B           DGKVLFLTEKGMKEFEE----------------------------------
2acjC           PPL------------------------------------------------
2a61B           RAYFLVITRKGEEVIEKVIERRENFIEKITSDLGK----------------
3df8A           ITTYALTEKGNVRNSLPLLQYISVLDR------------------------
2acjA           ---------------------------------------------------
1b1bA           HLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEA----------
3cjnA           QRSSRVYLTPAGRAVYDRLWPHRASHDRFQGITPQERQAFL----------
2b0lB           MKGT-----------------------------------------------
3bddD           LVWPTEQAREALITNPSAHHQAIKTSNQILT--------------------
1dpuA           FKST-----------------------------------------------
2ek5A           QAPALIRERRDAAFAATYVAPLIDETRARIHALLDQVAESR----------
3boqB           SAKLTDAGLTTFKQASEAHNRILAELLRAVS--------------------
2dlbA           GSV------------------------------------------------
2acjB           ---------------------------------------------------
2e1cA           SMLAFILVKVKAGKYSEVASNLAKYPEIVYETTGDYDMVVKIRTKN-----
2ek5C           GFVSAQA-PALIRERRDAAFAATYVAPLIDESIHLGF--------------
2du9A           QAPALIRERRDAAFAATYVAPLIDESRARIHALLDQVAESR----------
2cyyA           ---------------------------------------------------
1bg3A           ---------------------------------------------------
3by6C           GTF---ITGNTASVKNSNQNRLLADLSQVIAEL------------------
1aoyA           VYC------------------------------------------------
2d45B           KIFQYYSLVEESDIKYKTSKNFINKVY------------------------
2d45A           KIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLV----------------
3bddA           DNQR-----------------------------------------------
1dtr-           SLQMTPTGRTLATAVMRKHRLAERLLT------------------------
1dprA           SLQMTPTGRTLATAVMRK---------------------------------