[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08687.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e5bA.bssp"
#ERROR : Can't open dsspfile "3e5bC.bssp"
#ERROR : Can't open dsspfile "3b8iC.bssp"
#ERROR : Can't open dsspfile "3b8iA.bssp"
#ERROR : Can't open dsspfile "3b8iB.bssp"
#ERROR : Can't open dsspfile "3b8iD.bssp"
#ERROR : Can't open dsspfile "3b8iE.bssp"
#ERROR : Can't open dsspfile "3d8vA.bssp"
#ERROR : Can't open dsspfile "2e3dA.bssp"
#ERROR : Can't open dsspfile "2csbA.bssp"
#ERROR : Can't open dsspfile "3duvB.bssp"
#ERROR : Can't open dsspfile "2e3dC.bssp"
#ERROR : Can't open dsspfile "2e3dB.bssp"
#ERROR : Can't open dsspfile "3e5bD.bssp"
#ERROR : Can't open dsspfile "3brkX.bssp"
#ERROR : Can't open dsspfile "3dj4A.bssp"
#ERROR : Can't open dsspfile "3d98A.bssp"
#ERROR : Can't open dsspfile "3dk5A.bssp"
#ERROR : Can't open dsspfile "2e3dD.bssp"
#ERROR : Can't open dsspfile "3duvA.bssp"
#ERROR : Can't open dsspfile "3di0A.bssp"
#ERROR : Can't open dsspfile "3cgxA.bssp"
#ERROR : Can't open dsspfile "3e5bB.bssp"
#ERROR : Can't open dsspfile "2dpwA.bssp"
#ERROR : Can't open dsspfile "3di1B.bssp"
#ERROR : Can't open dsspfile "2a6nA.bssp"
#ERROR : Can't open dsspfile "1dquA.bssp"
#ERROR : Can't open dsspfile "2e8bA.bssp"
#ERROR : Can't open dsspfile "2cu2A.bssp"
#ERROR : Can't open dsspfile "3daqA.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "3d0cA.bssp"
#ERROR : Can't open dsspfile "3d5nA.bssp"
#ERROR : Can't open dsspfile "3di0B.bssp"
#ERROR : Can't open dsspfile "3d5nE.bssp"
#ERROR : Can't open dsspfile "3c0jA.bssp"
#ERROR : Can't open dsspfile "3d5nB.bssp"
#ERROR : Can't open dsspfile "2ehhA.bssp"
#ERROR : Can't open dsspfile "3di1A.bssp"
#ERROR : Can't open dsspfile "3d5nF.bssp"
#ERROR : Can't open dsspfile "2ehhC.bssp"
#ERROR : Can't open dsspfile "3d5nH.bssp"
#ERROR : Can't open dsspfile "2a6lA.bssp"
#ERROR : Can't open dsspfile "1b4eA.bssp"
#ERROR : Can't open dsspfile "3d5nI.bssp"
#ERROR : Can't open dsspfile "3d5nG.bssp"
#ERROR : Can't open dsspfile "3eb2A.bssp"
#ERROR : Can't open dsspfile "3eb2D.bssp"
#ERROR : Can't open dsspfile "3d0cB.bssp"
#ERROR : Can't open dsspfile "3c8vD.bssp"
#ERROR : Can't open dsspfile "3bi8A.bssp"
#ERROR : Can't open dsspfile "3bq6B.bssp"
#ERROR : Can't open dsspfile "3eb2B.bssp"
#ERROR : Can't open dsspfile "2dzbB.bssp"
#ERROR : Can't open dsspfile "3b4uB.bssp"
#ERROR : Can't open dsspfile "2aqwA.bssp"
#ERROR : Can't open dsspfile "3c8vC.bssp"

## Summary of PDB Search
:564
    8e-31  19%  3e5bA  [x.x.x] ISOCITRATE LYASE
    6e-23  19%  3e5bC  [x.x.x] ISOCITRATE LYASE
    7e-23  22%  3b8iC  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    6e-20  23%  3b8iA  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    2e-19  23%  3b8iB  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    2e-18  26%  3b8iD  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    8e-17  27%  3b8iE  [x.x.x] PA4872 OXALOACETATE DECARBOXYLASE
    4e-15  22%  3d8vA  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    9e-15  19%  2e3dA  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    2e-14  13%  2csbA  [x.x.x] TOPOISOMERASE V
    3e-14  13%  3duvB  [x.x.x] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    1e-13  34%  2e3dC  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-13  16%  2e3dB  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    3e-13  17%  3e5bD  [x.x.x] ISOCITRATE LYASE
    3e-13  24%  3brkX  [x.x.x] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE
    8e-13  22%  3dj4A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    1e-12  25%  3d98A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    4e-12  28%  3dk5A  [x.x.x] BIFUNCTIONAL PROTEIN GLMU
    8e-12  20%  2e3dD  [x.x.x] UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    1e-11  16%  3duvA  [x.x.x] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    2e-11  14%  3di0A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    7e-11  10%  3cgxA  [x.x.x] PUTATIVE NUCLEOTIDE-DIPHOSPHO-SUGAR TRANSFERASE
    1e-10  19%  3e5bB  [x.x.x] ISOCITRATE LYASE
    1e-10  21%  2dpwA  [x.x.x] HYPOTHETICAL PROTEIN TTHA0179
    2e-10  16%  3di1B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    2e-10  13%  2a6nA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-10  16%  1dquA  [c.1.12] ISOCITRATE LYASE
    4e-10  17%  2e8bA  [x.x.x] PROBABLE MOLYBDOPTERIN-GUANINE DINUCLEOTIDE
    4e-10  20%  2cu2A  [x.x.x] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL
    1e-09  12%  3daqA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-09  19%  1e5kA  [c.68.1] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    4e-09  14%  3d0cA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    4e-09  18%  3d5nA  [x.x.x] Q97W15_SULSO
    5e-09  15%  3di0B  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-09  17%  3d5nE  [x.x.x] Q97W15_SULSO
    6e-09  11%  3c0jA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    7e-09  17%  3d5nB  [x.x.x] Q97W15_SULSO
    1e-08  15%  2ehhA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    1e-08  14%  3di1A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-08  17%  3d5nF  [x.x.x] Q97W15_SULSO
    3e-08  14%  2ehhC  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    8e-08  17%  3d5nH  [x.x.x] Q97W15_SULSO
    9e-08  12%  2a6lA  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    6e-07  14%  1b4eA  [c.1.10] PROTEIN (5-AMINOLEVULINIC ACID DEHYDRATASE)
    1e-06  14%  3d5nI  [x.x.x] Q97W15_SULSO
    1e-06  14%  3d5nG  [x.x.x] Q97W15_SULSO
    2e-06  15%  3eb2A  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    4e-06  19%  3eb2D  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    9e-06  12%  3d0cB  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    9e-06  10%  3c8vD  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    3e-05  11%  3bi8A  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    3e-05  15%  3bq6B  [x.x.x] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-
    2e-04  16%  3eb2B  [x.x.x] PUTATIVE DIHYDRODIPICOLINATE SYNTHETASE
    2e-04  18%  2dzbB  [x.x.x] DIHYDROPTEROATE SYNTHASE
    6e-04  15%  3b4uB  [x.x.x] DIHYDRODIPICOLINATE SYNTHASE
    8e-04  12%  2aqwA  [x.x.x] PUTATIVE OROTIDINE-MONOPHOSPHATE-DECARBOXYLASE
    9e-04   9%  3c8vC  [x.x.x] PUTATIVE ACETYLTRANSFERASE
:564

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxHDPNLLATSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASW
3e5bA           --------LAEMGANRLWKLIHEEDFVNALGALSGNQAMQMVRAGLKAIYLSGDANTASAMYPDQSLYPA
3e5bC           -------SLAEMGANRLWKLIHEEDFVNALGALSGNQAMQMVRAGLKAIYLSGWQVAADANNRTLQRADQ
3b8iC           ---------------MFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQLAAPDFALITL
3b8iA           -----------ELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLVLAAPDFALITL
3b8iB           -----------ELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQLAAPDFALITL
3b8iD           -----------ELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQLAAPDFALITL
3b8iE           -----------ELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQLAAPDFALITL
3d8vA           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
2csbA           --------------------------------YDAEFVGSEREEEERETFLKGVKAY--DGVLATRYLER
3duvB           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
3e5bD           ------------SLAEMGANRLWKLIHNALGALSGNQAMQMVRAGLKAIYLSGWQVAAKRINRTLQRADQ
3brkX           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
3duvA           ----------------------------------------------------------------------
3di0A           ----------------------------------------------------------------------
3cgxA           ----------------------------------------------------------------------
3e5bB           -------SLAEMGANRLWKLIHEEDFVNALGALSGNQAMQMVRAGLKAIYLSGWQVAAKRINRTLQRADQ
2dpwA           ----------------------------------------------------------------------
3di1B           ----------------------------------------------------------------------
2a6nA           ----------------------------------------------------------------------
1dquA           ---YPSNVQAKKLWGILERNFKNKEASFTYGCLDPTMVTQMA-KYLDTVYVSGLWMAQLFHDRKQREERM
2e8bA           ----------------------------------------------------------------------
2cu2A           ----------------------------------------------------------------------
3daqA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
3d0cA           ----------------------------------------------------------------------
3d5nA           ----------------------------------------------------------------------
3di0B           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3c0jA           ----------------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
3di1A           ----------------------------------------------------------------------
3d5nF           ----------------------------------------------------------------------
2ehhC           ----------------------------------------------------------------------
3d5nH           ----------------------------------------------------------------------
2a6lA           ----------------------------------------------------------------------
1b4eA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3d0cB           ----------------------------------------------------------------------
3c8vD           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
3bq6B           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
3b4uB           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3c8vC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLAD
3e5bA           NAGPELAKRINRTWFAPIVADAEAGFGGPLDAFEIMKAYIEAGAAGVHFEDQL---------ASGKVLIP
3e5bC           IETAEGKGLSVDTWFAPIVADAEAGFGGPLDAFEIMKAYIEAGAAGVHFEDQLASGKV---------LIP
3b8iC           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEE
3b8iA           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEE
3b8iB           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEE
3b8iD           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTI-----EDTLLPAQFRSTDLIC
3b8iE           SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKS---TDLIC
3d8vA           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
2csbA           SSSAKNDEELLELHQNFILLTGSYACSIDPTEDRYQN----VIVRGVNFDERVQRLSTGGSPARYAI--V
3duvB           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
3e5bD           IETAEGKGLSVDTWFAPIVADAEAGFGGPLDAFEIMKAYIEAGAAGVHFEDQLASGGKVLI--------P
3brkX           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
3duvA           ----------------------------------------------------------------------
3di0A           ---------LFEGVGVALTTPFTNNKVNIEALKTHVNFLLENNAQAIIV---------NGTTAESPTLTT
3cgxA           ----------------------------------------------------------------------
3e5bB           IETAEGKGLSVDTWFAPIVADAEAGFGGPLDAFEIMKAYIEAGAAGVHFEDQLASG------KVLIPTAA
2dpwA           ----------------------------------------------------------------------
3di1B           ---------LFEGVGVALTTPFTNNKVNIEALKTHVNFLLENNAQAIIVNGTT---------AESPTL-T
2a6nA           ---------SIVAIVTPMDEKGNVCRASL---KKLIDYHVASGTSAIVSVG----------TTGESATLN
1dquA           TTPKDQRHKVANVYLRPIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTK----GKVLVPISE
2e8bA           ----------------------------------------------------------------------
2cu2A           ----------------------------------------------------------------------
3daqA           ---------LFEGVGVALTTPFTNNKVNLEALKAHVNFLLENNAQAIIVN-------GTTAESPTLTTDE
1e5kA           ----------------------------------------------------------------------
3d0cA           --------FSTISGINIVPFLEGTREIDWKGLDDNVEFLLQNGIEVIVPNGN---------TGEFYAL-T
3d5nA           ----------------------------------------------------------------------
3di0B           ---------LFEGVGVALTTPFTNNKVNIEALKTHVNFLLENNAQAIIVNG---------TTAESPTL-T
3d5nE           ----------------------------------------------------------------------
3c0jA           ---------SIVAIVTPMDEKGNVCRASL---KKLIDYHVASGTSAIVSVG----------TTGESATLN
3d5nB           ----------------------------------------------------------------------
2ehhA           ---------MFQGSIVALITPFKEGEVDYEALGNLIEFHVDNGTDAILVCGT---------TGESPTLTF
3di1A           ---------LFEGVGVALTTPFTNNKVNIEALKTHVNFLLENNAQAIIVNG----------TTAESPTLT
3d5nF           ----------------------------------------------------------------------
2ehhC           ------------GSIVALITPFKEGEVDYEALGNLIEFHVDNGTDAILVCGT---------TGESPTL-T
3d5nH           ----------------------------------------------------------------------
2a6lA           ------FTGSIVAIVTPMDEKGNVCRASL---KKLIDYHVASGTSAIVSVG----------TTGESATLN
1b4eA           -------------------------------VQAIRQALDAAGFKDTAIMSYS---------TKFASSFY
3d5nI           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
3eb2A           -----DFHGVFPYLVSPVDAEGRVRADVM---GRLCDDLIQAGVHGLTPLGS-------TGEFAYLGTAQ
3eb2D           -----DFHGVFPYLVSPVDAEGRVRADVM---GRLCDDLIQAGVHGLTPLGS---------TGEFAYLGT
3d0cB           ---------------NIVPFLEGTREIDWKGLDDNVEFLLQNGIEVIVPNG----------NTGEFYALT
3c8vD           ----------------------------------------------------------------------
3bi8A           ---------------------------DFDKLSELIEWHIKSKTDAIIVCGTTGEATT-------MTETE
3bq6B           ---------MSWSYYREDIPEREIAYQIALAINEEVKDLEEAGIKIVQIDEPAFREKAPIKKS--KWPEY
3eb2B           -----DFHGVFPYLVSPVDAEGRVRADVM---GRLCDDLIQAGVHGLTP--------LGSTGE--FAYLG
2dzbB           ----------------------------------------------------------------------
3b4uB           ---------------------------DIDAMIAHARRCLSNGCDSVTLFGTT---------GEGCSVGS
2aqwA           ----------------------------------------------------------------------
3c8vC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFAR
3e5bA           TAAHIRNLNAARLAVMGTPTLIVARTDAEAAKLLTSDIDERDQPFVDYEAGRTAEGFYQVKNGIEPCIAR
3e5bC           TAAHIRNLNAARLDVMGTPTLIVARTDAEAAKLLTSDIDERDQPFVDYEAGRTAEGFYQVKNGIEPCIAR
3b8iC           GVGKIRAALEARVDPALTIIARTNAELI-----DVDAVIQRTLAYQEAGADGICLVGVRDFA-----HLE
3b8iA           GVGKIRAALE-----ARVDPALTIIARTNAELIDVDAVIQRTLAYQEAGADGICLVGVRD-----FAHLE
3b8iB           GVGKIRAALEARVDPALTIIARTNAEL-----IDVDAVIQRTLAYQEAGADGICLVGVRD-----FAHLE
3b8iD           VEEGVGKIRAALEARVDPALTIIARTNA--ELIDVDAVIQRTLAYQEAGADGICLVGVRDFA-----HLE
3b8iE           VEEGVGKIRAALEARVDPALTIIARTNA--ELIDVDAVIQRTLAYQEAGADGICLVGVRDFA-----HLE
3d8vA           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
2csbA           YRRGWRAIAKALDIDEEDVPAIEVRAVK--RNPLQPALYRILVRYGRVDLPVTVDEVPPE-AGEFERLIE
3duvB           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
3e5bD           TAAHIRNLNAARLAVMGTPTLIVARTDAEAAKLLTSDIDERDQPFVDYEAGRTAEGFYQVKNGIEPCIAR
3brkX           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
3duvA           ----------------------------------------------------------------------
3di0A           -DEKERILKTVIDLVDKRVP-----VIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVK
3cgxA           ----------------------------------------------------------------------
3e5bB           HIRNLNAARLAADV-MGTPTLIVARTDAEAAKLLTSDIDERDQPFVDYEAGRTADLIWMETSKPDLAQAR
2dpwA           ----------------------------------------------------------------------
3di1B           TDEKERILKTVIDLVDKRVP-----VIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVK
2a6nA           HDEHADVVMMTLDLADGRIP-----VIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQ
1dquA           HINRLVAIRAQADIMGTDLL-AIARTDSEAATLITSTIDHRDHPFIIGSTNPDIQPLNGKNGAELQAIED
2e8bA           ----------------------------------------------------------------------
2cu2A           ----------------------------------------------------------------------
3daqA           KELI---LKTVIDLVDKRVP-----VIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVK
1e5kA           ----------------------------------------------------------------------
3d0cA           IEEAKQVATRVTELVNGRATVVAG------IGYSVDTAIELGKSAIDSGADCVIHHPYITDAGAVEYYRN
3d5nA           ----------------------------------------------------------------------
3di0B           TDEKERILKTVIDLVDKRVP-----VIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVK
3d5nE           ----------------------------------------------------------------------
3c0jA           HDEHADVVMMTLDLADGRIPVIAG-----TGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQ
3d5nB           ----------------------------------------------------------------------
2ehhA           -EEHEKVIEFAVKRAAGRIKVIAG-----TGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYE
3di1A           TDEKERILKTVIDLVDKRVP-----VIAGTGTNDTEKSIQASIQAKALGADAIMLITPYYNKTNQRGLVK
3d5nF           ----------------------------------------------------------------------
2ehhC           FEEHEKVIEFAVKRAAGRIKVIAG-----TGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYE
3d5nH           ----------------------------------------------------------------------
2a6lA           HDEHADVVMMTLDLADGRIP-----VIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQ
1b4eA           -GPFREAAGSALKG---------DRKSYQMNPMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRE
3d5nI           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
3eb2A           REAVVRATIEAAQRRVP--------VVAGVASTSVADAVAQAKLYEKLGADGILAILEALKDAQIESYFR
3eb2D           AQ--REAVVRATIEAAQRRVPVVAGV----ASTSVADAVAQAKLYEKLGADGILAILEAYFPLKDAQIES
3d0cB           IEEAKQVATRVTELVNGRATVVAG------IGYSVDTAIELGKSAIDSGADCVIHQPYITDAGAVEYYRN
3c8vD           ----------------------------------------------------------------------
3bi8A           RKETIKFVID----KVNKRIPVIAGT----GSNNTAASIAMSKWAESIGVDGLLVITPYYNKTTQKGLVK
3bq6B           FEWAINAFNLAANARPETQIHAHMCY---------SDFNEIIEYIHQLEFDVISIEASRSKGEIISAFEN
3eb2B           TAQREAVVRATIEAAQRRVPVVAG-----VASTSVADAVAQAKLYEKLGADGILAILEAYFPLKDAQIES
2dzbB           -----------------------------------ERALERAREMVAEGADILDLGAESTPVEEEKRRLL
3b4uB           -RERQAILSSFIAAGIAPSRIVTG-----VLVDSIEDAADQSAEALNAGARNILLAPNVS-DDGLFAWFS
2aqwA           ---------------------------------------YRKFIFEYLKSDSCTINVYGTNLDICFDYEK
3c8vC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNE
3e5bA           AIAYHKAHPGKLLAYNCSPQRELGAMGYKFQFITLAGFHQLNYGMFELARGYKDRQMAAYSELQQAEFAA
3e5bC           AIAYHKAHPGKLLAYNCSPSRELGAMGYKFQFITLAGFHQLNYGMFELARGYKDRQMAAYSELQQAEFAA
3b8iC           AIAEHLHILMLVTYGNPQLRDDARLAGVRVVVNGHAAYFAAIKATYDCLREERGALTASELSKKYTFPEE
3b8iA           AIAEHLHILMLVTYGNPQLRDDARLAGVRVVVNGHAAYFAAIKATYDCLREERG------AVASDLTASE
3b8iB           AIAEHLHILMLVTYGNPQLRDDARLAGVRVVVNGHAAYFAAIKATYDCLREERG------AVASDLTASE
3b8iD           AIAEHLHILMLVTYGNPQLRDDARLAGVRVVVNGHAAYFAAIKATYDCLREER------GAVASDLTASE
3b8iE           AIAEHLHILMLVTYGNPQLRDDARLAGVRVVVNGHAAYFAAIKATYDCLREERG------AVASDLTASE
3d8vA           ----------------------------------------------------------------------
2e3dA           ----------------------------------------------------------------------
2csbA           --RYDVPIDILRENPWTPHDEIARRLGLSVSEVEGEKDPESSGIYSLWSRVVV-----------------
3duvB           ----------------------------------------------------------------------
2e3dC           ----------------------------------------------------------------------
2e3dB           ----------------------------------------------------------------------
3e5bD           AIAYHKAHPGKLLAYNCSPSRELGAMGYKFQFITLAGFHQLNYGMFELARGYKDRQMAAYSELQ--QAEF
3brkX           ----------------------------------------------------------------------
3dj4A           ----------------------------------------------------------------------
3d98A           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
2e3dD           ----------------------------------------------------------------------
3duvA           ----------------------------------------------------------------------
3di0A           HFEAIADAVKLPVVLYNVPPETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGNDDNVVEY
3cgxA           ----------------------------------------------------------------------
3e5bB           RFAEAKAHPGKLLAYNCSPQRELGAMGYKFQFITLAGFHQLNYGMFELARGYKDRQMAAYSELQQAEFAA
2dpwA           ----------------------------------------------------------------------
3di1B           HFEAIADAVKLPVVLYNVP---------------------------------------------------
2a6nA           HFKAIAEHTDLPQILYNVPPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASAL---
1dquA           EWLAKAGLKLFNDAVVDINNSPLPNKKAAIEKYLTQSKGKSNLEARAIAKEIAGTDIYFDWEAPRTREGY
2e8bA           ----------------------------------------------------------------------
2cu2A           ----------------------------------------------------------------------
3daqA           HFEAIADAVKLPVVLYNVPSETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALYSGN-------
1e5kA           ----------------------------------------------------------------------
3d0cA           IIEADAPSIIYFKDAHLSDDVIKELAPLDKLVGIKY-AINDIQRVTQVRAVPKS----------------
3d5nA           ----------------------------------------------------------------------
3di0B           HFEAIADAVKLPVVLYNVPSRTNMTIEPETVIVALKDATNDFEYLEEVKKRIDTNSFALY----------
3d5nE           ----------------------------------------------------------------------
3c0jA           HFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIEATGNLTRVNQ----------------
3d5nB           ----------------------------------------------------------------------
2ehhA           HFKTVAQEVDIPIIIYNIPSRTCV------EISVDTMFKLASECENIVASKE-STPNMDRISEIVKRLGE
3di1A           HFEAIADAVKLPVVLYNVPSETVEILSQHPYIVALKDATNDFEYLEEVKKRIDTNSFALY----------
3d5nF           ----------------------------------------------------------------------
2ehhC           HFKTVAQEVDIPIIIYNIPSRTCVEIS------VDTMFKLASECENIVASKESTPNMDRISEIVKRLGES
3d5nH           ----------------------------------------------------------------------
2a6lA           HFKAIAEHTDLPQILYNVLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASAL---
1b4eA           RTELPIGAYQVS----------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
3eb2A           AIADAVEIPVVIYTNPQFQRSDIARLAEHPRIRYIKDASTNTGRLLSIINRCGDALQVFSASAHIP----
3eb2D           YFRAIADAVEIPVVIYTNPQDVIARLAEHPRIRYIKDASTNTGRLLSIINRCGDALQVFSASAHIP----
3d0cB           IIEADAPSIIYFKDAHLSDDVIAPLDKLVGIKYAINDIQRVTQVRAVPKSSN------------------
3c8vD           ----------------------------------------------------------------------
3bi8A           HFKAVSDAVSTPIIIYNVP---GRTGLNITPGTLKELCEDKNIVAVKEASGNIS-----QIAQIKALCGD
3bq6B           FKGWIKQI--------------------------------------------------------------
3eb2B           YFRAIADAVEIPVVIYTNPQDVIARLAEHPRIRYIKDASTNTGRLLSIINRCGDALQVFSASAHIP----
2dzbB           PVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGLRDERMVALAARHGVAAVVMHM---------
3b4uB           AVFSKIGKDARDILVYNIP---------------------------------------------------
2aqwA           NKYYSAYVLIKTTNKDSFIFQNELSINDKQAYIVADETQKAT----------------------------
3c8vC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IFRLQDADEYSAAEKIYLTGGQAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGI
3e5bA           EADGYTATKH------------------------------------------------------------
3e5bC           EADGYTATKH------------------------------------------------------------
3b8iC           YQAWARDY--------------------------------------------------------------
3b8iA           LSKYTFPEEYQAWARDY-----------------------------------------------------
3b8iB           LSKYTFPEEYQAWARDY-----------------------------------------------------
3b8iD           LSKYTFPEEYQAWARDY-----------------------------------------------------
3b8iE           LSKYTFPEEYQAWARDY-----------------------------------------------------
3d8vA           --------------------------VLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAP
2e3dA           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
2csbA           ----------------------------------------------------------------------
3duvB           --------------------------VIIPARFASSRL------PGKPLADIKGKPIQHVFEKAL-QSGA
2e3dC           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
2e3dB           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
3e5bD           AAEADGYTATKHQREVGTGYFD-AVSLAI-----------------------------------------
3brkX           --------------------------AYVLAGGRGSRLKELTDRRAKPAVYFGGKARIIDFALSNLNSGI
3dj4A           --------------------------VLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAP
3d98A           --------------------------VLVLAAGPGTRMRSDT---PKVLHTLAGRSMLSHVLHAIAKLAP
3dk5A           ------------------------TAVLVLAAGPGTRMRS---DTPKVLHTLAGRSMLSHVLHAIAKLAP
2e3dD           --------------------------AVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGI
3duvA           --------------------------------------------------IIPARKPIQHVFEKALQSGA
3di0A           Y---------------------------------------------------------------------
3cgxA           --------------------------VKYPEPGKVK--TRLGEV-VGNDKAALYRHFVQDLQGLARLHAD
3e5bB           EADGYTA---------------------------------------------------------------
2dpwA           --------------------------AIVLAGGKEAWAE-RFGVGSKALVPYRGRPVEWVLEALYAAGLS
3di1B           ----------------------------------------------------------------------
2a6nA           ----------------------------------------------------------------------
1dquA           YRYQGGTQCAINRAVAYAPFADLIWMESKLPDYKKEFADGVHAVWPEQKLAYNLSPSFNWKKAMPRDE--
2e8bA           -------------------------TCYVLAGGKSKRF-----GEDKLLYEIKGKKVIERVYETAKSVFK
2cu2A           --------------------------ALVMAGGRGERLWPLSEDRPKPFLPLFEKTLLEATLERLAPLVP
3daqA           ----------------------------------------------------------------------
1e5kA           --------------------------GVVLAGGKARRMG----GVDKGLLELNGKPLWQHVADALMTQLS
3d0cA           ----------------------------------------------------------------------
3d5nA           --------------------------VIILAAGEGKRF-----GGDKLLAKIDNTPIIRTIR----IYGD
3di0B           ----------------------------------------------------------------------
3d5nE           --------------------------VIILAAGEDKL-----------LAKIDNTPIIRTIR----IYGD
3c0jA           ----------------------------------------------------------------------
3d5nB           --------------------------VIILAAG------------DKLLAKIDNTPIIRTIR----IYGD
2ehhA           SFSVLSGDDSLTLPMMALKGVISVANNVMPREVKELIRAALEGDFRRARIHYYLHDLFKVLFIETNPIPV
3di1A           ----------------------------------------------------------------------
3d5nF           --------------------------VIILAAG------------DKLLAKIDNTPIIRTIRI----YGD
2ehhC           FSVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAALEGDFRRAREIHYYDLFKVLFIETNPIPV
3d5nH           --------------------------VIILAAGEGDKL----------LAKIDNTPIIRTIR----IYGD
2a6lA           ----------------------------------------------------------------------
1b4eA           ----------------------------------------------------------------------
3d5nI           ---------------------------------------------AKLLAKIDNTPIIRTIRI----YGD
3d5nG           --------------------------VIILAA--------------KLLAKIDNTPIIRTIRI----YGD
3eb2A           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3d0cB           ----------------------------------------------------------------------
3c8vD           -----------------------------------------------------------TQLELLLERII
3bi8A           KLDIYSGNDDQIIPILALGGIGVISVANVIPEDVHNMCELYLNGKVNEALKIQLDALTNALFIETNPIPV
3bq6B           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
3b4uB           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3c8vC           ----------------------------------GTQLELLLEIIDRVNVNLRHQFDVGDYVRRQTPHLH


                         .         .         .         .         *         .         .:420
query           NDITVVGGYKAEAIDAAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAP
3e5bA           ----------------------------------------------------------------------
3e5bC           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iD           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
3d8vA           QRLIVVLGHDHQRIAPLGRTIDVALQDRPLGTGHAVLCGLSALPGNVVVTSGDTLLDADTLADLIATSAA
2e3dA           TEIVLVTHSSKNSIENHHVTIMQVRQGLAKGLGHAVLCAHPVVGDEPVAVILPDVILDEYESDLSQDNEM
2csbA           ----------------------------------------------------------------------
3duvB           SRVIIATDNENDVAKSFGAEVCTVNHNSGTERLAEVVEKLAIPDNEIINIQGDEPLIPVIVRQVADNFNV
2e3dC           TEIVLVTHSSKNSI--------------------------------------------------------
2e3dB           TEIVLVTHSSKNSIENHFDTSFELEAMLEKRQLLDEVQSICPPHVTIMQQGKGLGHAVLCAHPVVGDEPV
3e5bD           ----------------------------------------------------------------------
3brkX           RRIGVATQYKAHSLPERNESFDILPASWYEGTADAVYQNIDIIEPYAVILAGDIYKDYEYLQQHVDSGAD
3dj4A           QRLIVVLGHDHQRIDTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYANVVVTPLLDADTLADLIATHRA
3d98A           QRLIVVLGHDHQRIAPLVGELADTLGRRPLGTGHAVLCGLSALPGNVVVTSGDTLLDADTLADLIATHR-
3dk5A           QRLIVVLGHDHQRIAPLTIDVALQDRPLGTGHLCGLSALPDDYAGNVVVTSGD-----------------
2e3dD           TEIVLVTHSSKNSIENHFDTSFELEAMLKRQLLDEVQSICPPHVTIMQVRQGKGLGHAVLCAHPVVGDEP
3duvA           SRVIIATDNEADVAKSFGAEVCTSVNHNSGTELAEVVEKLAIPDNEIINIQGDEPLIPQVADNLAKFNVN
3di0A           ----------------------------------------------------------------------
3cgxA           LHICYVPGDADLPEKFKGPQHFAAQQGLDLGERKHAQKAFDDGYDRVVLGSDIPDYPCELVQKALNDLQH
3e5bB           ----------------------------------------------------------------------
2dpwA           PVYVGENPGLVP--------APALTLPDRGGLLENLEQALEHVEGRVLVATGDIPHLTEAVRFVLD----
3di1B           ----------------------------------------------------------------------
2a6nA           ----------------------------------------------------------------------
1dquA           ------QETYIKRLGALGYAWQFITLAGLHTTALISDTFAKAYAKQGMRAYGELV---------------
2e8bA           EVYIVAKDREKFSFLNA---PVVLDEFEESASIIGLYTALKHAKEENFVLSGDLPLMKKVLENFKEPVSV
2cu2A           PERTLLAVRRDARPYADGIRLLLEPLGRDTAG-AVLLGVAEALKEGALVLPADH----YVGDDEAYREAL
3daqA           ----------------------------------------------------------------------
1e5kA           HVVVNANRHQEIYQ-ASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFCPCDTPYIPPDLAARLNHQRKD
3d0cA           ----------------------------------------------------------------------
3d5nA           LEKIIIVGKYVNELPLLDQIVIYNPFW-NEGISTSLKLGLRFFKDYDLVALGDPFVTKEDVNKIIN----
3di0B           ----------------------------------------------------------------------
3d5nE           LEKIIIVGKYVNEL-PLLDQIVIYNPFWNEGISTSLKLGLRFFKDYDLVALGDPFVTKEDVNKIIN----
3c0jA           ----------------------------------------------------------------------
3d5nB           LEKIIIVGKYVNELPLLDQIVIYNPFW-NEGISTSLKLGLRFFKDYDLVALGDPFVTKEDVNKIIN----
2ehhA           KTACWMLGMCEKEF--------------------------------------------------------
3di1A           ----------------------------------------------------------------------
3d5nF           LEKIIIVGKYVNEL-PLLDQIVIYNPFWNEGISTSLKLGLRFFKDYDLVALGDPFVTKEDVNKIIN----
2ehhC           KTACWMLGMCEKE---------------------------------------------------------
3d5nH           LEKIIIVGKYVNEL-PLLDQIVIYNPFWNEGISTSLKLGLRFFKDYAVLVALGDPFVTKEDVNKI-----
2a6lA           ----------------------------------------------------------------------
1b4eA           ----------------------------------------------------------------------
3d5nI           LEKIIIVGKYVNEL-PLLDQIVIYNPFWNEGISTSLKLGLRFFKDYDLVALGDPFVTKEDVNKIIN----
3d5nG           LEKIIIVGKYVNELLLDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDPFVTKEDVNKIIN----
3eb2A           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3d0cB           ----------------------------------------------------------------------
3c8vD           DRVNVNLRHQKFDVRRQTPHLHYKFYAFYGLSADDPVHFHFKNSLGRVNVLHSALYKSDIRGDELKRKGQ
3bi8A           KTAMNLMNMKVGDL--------------------------------------------------------
3bq6B           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
3b4uB           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3c8vC           YSKFYAFYGLSADDPVHFHFSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHKIPLHDDEVITIKDSF


                         .         .         +         .         .         .         .:490
query           FSVVVDSSESAPSNQSVRDFAWCSAADDRDLFGQKVLLRKISDTPAATDGEPHGRWIGLLNVRGEGRARL
3e5bA           ----------------------------------------------------------------------
3e5bC           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iD           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
3d8vA           VTVLTTTLDDPFGYGRIL-------------RTQDHEVMAIVEQTDATPSQREIREVGVYAFD---IAAL
2e3dA           IRRFDETGHSQIMVEPVADYGVVDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLL
2csbA           ----------------------------------------------------------------------
3duvB           NASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYDRDQFNLQDVQKVQLSDAYLRHIGIYAYRA
2e3dC           ----------------------------------------------------------------------
2e3dB           AVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTVDCKGVELAPGESKADVAPSNLAIV
3e5bD           ----------------------------------------------------------------------
3brkX           VTIGC-----------------------------------------------------------------
3dj4A           VSAAVTVLTTTLDDPF--GYGRILRTQD-----HEVM--AIVEQTDATPSQREIREVGVYAFD---IAAL
3d98A           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
2e3dD           VAVILP------------DVILDEYESDLSQDNLAEMIRRFDETGHSQIMDVTAY--GVVDCKGVELAPG
3duvA           ASLAVKIHDAEEKDGYVLYFSRSVIPYDRDQFNLQ-------DVQKVQLSDAYLRHIGIYAYR---AGFI
3di0A           ----------------------------------------------------------------------
3cgxA           YDAAIGPAFDGGYYLIGFRKDSFCPDVFDGIR-----WGEADVYQPTVEKRRARLEVDWNDVTVWDLNVL
3e5bB           ----------------------------------------------------------------------
2dpwA           ----------------------------------------------------------------------
3di1B           ----------------------------------------------------------------------
2a6nA           ----------------------------------------------------------------------
1dquA           ----------------------------------------------------------------------
2e8bA           AKTEKLHTLVGV----------------------------------------------------------
2cu2A           ATMLEAAEEGFTRPETEYGYIRLGPREGAWYRGEGFVEKPSYAEALEYIRKGYVWNGGVFAFAPSHHEAL
3daqA           ----------------------------------------------------------------------
1e5kA           APVVW-----------------------------------------------------------------
3d0cA           ----------------------------------------------------------------------
3d5nA           ----------------------------------------------------------------------
3di0B           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3c0jA           ----------------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
3di1A           ----------------------------------------------------------------------
3d5nF           ----------------------------------------------------------------------
2ehhC           ----------------------------------------------------------------------
3d5nH           ----------------------------------------------------------------------
2a6lA           ----------------------------------------------------------------------
1b4eA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3d0cB           ----------------------------------------------------------------------
3c8vD           HFVCD-----------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
3bq6B           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
3b4uB           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3c8vC           LNKTLV----------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QKLLAELRQRPDFDSLDMPDLINALVEAGEKVEVRYVHGHWRGVNDLEDFRRAGDFAHTQTPxxxxxxxx
3e5bA           ----------------------------------------------------------------------
3e5bC           ----------------------------------------------------------------------
3b8iC           ----------------------------------------------------------------------
3b8iA           ----------------------------------------------------------------------
3b8iB           ----------------------------------------------------------------------
3b8iD           ----------------------------------------------------------------------
3b8iE           ----------------------------------------------------------------------
3d8vA           RSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLA-----------------
2e3dA           AKTPPE---------IQLTDAIDMLIEKETVEAYHM-KGKSHDCGNKLGYMQA-----------------
2csbA           ----------------------------------------------------------------------
3duvB           GFIKQYVQWAPTLENLEKLEQLRVLYNGERIHVELAKEVPAVGVDTAEDLEKVRAI--------------
2e3dC           ----------------------------------------------------------------------
2e3dB           GRYVLSADIWPLLAKTQLTDAIDMLIEKE-TVEAYHMKGKSHDCGNKLGYMQA-----------------
3e5bD           ----------------------------------------------------------------------
3brkX           ----------------------------------------------------------------------
3dj4A           RSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSA-----------------------------
3d98A           ----------------------------------------------------------------------
3dk5A           ----------------------------------------------------------------------
2e3dD           EDIWPLLAKTGAGDEIQLTDAIDMLIEKE-TVEAYHMKGKSHDCGNKLGYMQA-----------------
3duvA           KQYVQAPTQLENLEKLE----QLRVLYNGERIHVELAKEVAVGVDTAEDLEKV-----------------
3di0A           ----------------------------------------------------------------------
3cgxA           YRTNKNSSFR-------RSSTYALLRENDALIRQ------------------------------------
3e5bB           ----------------------------------------------------------------------
2dpwA           ----------------------------------------------------------------------
3di1B           ----------------------------------------------------------------------
2a6nA           ----------------------------------------------------------------------
1dquA           ----------------------------------------------------------------------
2e8bA           ----------------------------------------------------------------------
2cu2A           ERLLAGASLEEVYAGLPKISIDYGVMEKAERVRVVLGRFPWDDVGNWRALERVFSQDPHENV--------
3daqA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
3d0cA           ----------------------------------------------------------------------
3d5nA           ----------------------------------------------------------------------
3di0B           ----------------------------------------------------------------------
3d5nE           ----------------------------------------------------------------------
3c0jA           ----------------------------------------------------------------------
3d5nB           ----------------------------------------------------------------------
2ehhA           ----------------------------------------------------------------------
3di1A           ----------------------------------------------------------------------
3d5nF           ----------------------------------------------------------------------
2ehhC           ----------------------------------------------------------------------
3d5nH           ----------------------------------------------------------------------
2a6lA           ----------------------------------------------------------------------
1b4eA           ----------------------------------------------------------------------
3d5nI           ----------------------------------------------------------------------
3d5nG           ----------------------------------------------------------------------
3eb2A           ----------------------------------------------------------------------
3eb2D           ----------------------------------------------------------------------
3d0cB           ----------------------------------------------------------------------
3c8vD           ----------------------------------------------------------------------
3bi8A           ----------------------------------------------------------------------
3bq6B           ----------------------------------------------------------------------
3eb2B           ----------------------------------------------------------------------
2dzbB           ----------------------------------------------------------------------
3b4uB           ----------------------------------------------------------------------
2aqwA           ----------------------------------------------------------------------
3c8vC           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxx
3e5bA           ----
3e5bC           ----
3b8iC           ----
3b8iA           ----
3b8iB           ----
3b8iD           ----
3b8iE           ----
3d8vA           ----
2e3dA           ----
2csbA           ----
3duvB           ----
2e3dC           ----
2e3dB           ----
3e5bD           ----
3brkX           ----
3dj4A           ----
3d98A           ----
3dk5A           ----
2e3dD           ----
3duvA           ----
3di0A           ----
3cgxA           ----
3e5bB           ----
2dpwA           ----
3di1B           ----
2a6nA           ----
1dquA           ----
2e8bA           ----
2cu2A           ----
3daqA           ----
1e5kA           ----
3d0cA           ----
3d5nA           ----
3di0B           ----
3d5nE           ----
3c0jA           ----
3d5nB           ----
2ehhA           ----
3di1A           ----
3d5nF           ----
2ehhC           ----
3d5nH           ----
2a6lA           ----
1b4eA           ----
3d5nI           ----
3d5nG           ----
3eb2A           ----
3eb2D           ----
3d0cB           ----
3c8vD           ----
3bi8A           ----
3bq6B           ----
3eb2B           ----
2dzbB           ----
3b4uB           ----
2aqwA           ----
3c8vC           ----