[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF08803.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "1dj2A.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "3ce6B.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "1bmdA.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "3ce6A.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "2aw5B.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "2aw5C.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "2eghA.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "3ce6D.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "2dfdA.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "2e37D.bssp"
#ERROR : Can't open dsspfile "1bdmA.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "3c6cA.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "3d7lA.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "2e6gK.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "2a92C.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "1bxkB.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "3c2qA.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "1c9kB.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "3dxfB.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "3c2qB.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2e37C.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "2e37B.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "1c9yA.bssp"
#ERROR : Can't open dsspfile "3d7lD.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "3d64A.bssp"
#ERROR : Can't open dsspfile "3d3uA.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "3e03A.bssp"
#ERROR : Can't open dsspfile "2e6hD.bssp"
#ERROR : Can't open dsspfile "2e6cC.bssp"
#ERROR : Can't open dsspfile "3d7lB.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "1bdmB.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "2c5aB.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "3bzuC.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "3dfzA.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "2e6hB.bssp"
#ERROR : Can't open dsspfile "2c54A.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "1e6wD.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1cbuC.bssp"
#ERROR : Can't open dsspfile "2c82A.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "3d4nA.bssp"
#ERROR : Can't open dsspfile "3cq0B.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "2e37A.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"
#ERROR : Can't open dsspfile "1e6wC.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "1e3wA.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "2e6cD.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "2a92B.bssp"
#ERROR : Can't open dsspfile "3e6vA.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "1d4gA.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "2e6bD.bssp"
#ERROR : Can't open dsspfile "3e9nB.bssp"
#ERROR : Can't open dsspfile "2aw5A.bssp"
#ERROR : Can't open dsspfile "1b3rA.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "1cg1A.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "3dhnA.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "3e5mB.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "2e6bC.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "1d4fA.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "3e9nE.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"
#ERROR : Can't open dsspfile "2a92A.bssp"
#ERROR : Can't open dsspfile "2e6hC.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "1cg3A.bssp"
#ERROR : Can't open dsspfile "1e6wA.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "1edzA.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "2e6gA.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "1buaB.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "1di7A.bssp"
#ERROR : Can't open dsspfile "1dj3A.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "3e9nD.bssp"
#ERROR : Can't open dsspfile "3e5mA.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "2cukA.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "2a35A.bssp"
#ERROR : Can't open dsspfile "3e9qB.bssp"
#ERROR : Can't open dsspfile "2e6eD.bssp"
#ERROR : Can't open dsspfile "1cg4A.bssp"
#ERROR : Can't open dsspfile "3d7lF.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "3e9nH.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "3d5tC.bssp"
#ERROR : Can't open dsspfile "3d3jA.bssp"
#ERROR : Can't open dsspfile "3e9nF.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "2c5aA.bssp"
#ERROR : Can't open dsspfile "2e6eB.bssp"
#ERROR : Can't open dsspfile "3dtdB.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "3dfzB.bssp"
#ERROR : Can't open dsspfile "2eggA.bssp"
#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "1a7aB.bssp"
#ERROR : Can't open dsspfile "3dooA.bssp"
#ERROR : Can't open dsspfile "2e6gJ.bssp"
#ERROR : Can't open dsspfile "1a4iA.bssp"
#ERROR : Can't open dsspfile "1a4iB.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "3donA.bssp"
#ERROR : Can't open dsspfile "2eezA.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "3bywC.bssp"
#ERROR : Can't open dsspfile "2a35B.bssp"
#ERROR : Can't open dsspfile "2bkaA.bssp"
#ERROR : Can't open dsspfile "3e8xA.bssp"
#ERROR : Can't open dsspfile "3bywB.bssp"
#ERROR : Can't open dsspfile "1b0aA.bssp"
#ERROR : Can't open dsspfile "2e6gG.bssp"
#ERROR : Can't open dsspfile "3dqpA.bssp"
#ERROR : Can't open dsspfile "1civA.bssp"
#ERROR : Can't open dsspfile "3bywF.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "1ek6B.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "2ef0A.bssp"
#ERROR : Can't open dsspfile "3eheA.bssp"
#ERROR : Can't open dsspfile "2e6gB.bssp"
#ERROR : Can't open dsspfile "1e7rA.bssp"
#ERROR : Can't open dsspfile "1a7aA.bssp"
#ERROR : Can't open dsspfile "1buaA.bssp"
#ERROR : Can't open dsspfile "2c29D.bssp"
#ERROR : Can't open dsspfile "2b69A.bssp"
#ERROR : Can't open dsspfile "3bywD.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "1ddtA.bssp"
#ERROR : Can't open dsspfile "3d5tA.bssp"
#ERROR : Can't open dsspfile "1arzB.bssp"
#ERROR : Can't open dsspfile "3bywH.bssp"
#ERROR : Can't open dsspfile "2e6gF.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "3dtdA.bssp"

## Summary of PDB Search
:238
    2e-36  12%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    3e-35  27%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    1e-33  22%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-33  11%  1dj2A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    5e-32  29%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    1e-31  33%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    1e-31  23%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    1e-31  33%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    3e-31  10%  3ce6B  [x.x.x] ADENOSYLHOMOCYSTEINASE
    3e-30  32%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    9e-30  29%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    9e-30  20%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-29  27%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    8e-29  21%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-29  12%  1bmdA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    2e-28  11%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-28  24%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    3e-27  33%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    5e-27  10%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    6e-27  33%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    8e-27  22%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-26  23%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-26  11%  3ce6A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-26  26%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    8e-26  17%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    9e-26  21%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-25  22%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-25  21%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-25  21%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-25  16%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    8e-25  10%  2aw5B  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    9e-25  28%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    2e-24  23%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-24  21%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    3e-24   9%  2aw5C  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    3e-24  18%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-24  30%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    1e-23  26%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    2e-23  11%  2eghA  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    3e-23  15%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    3e-23  12%  3ce6D  [x.x.x] ADENOSYLHOMOCYSTEINASE
    4e-23  25%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-23  13%  2dfdA  [x.x.x] MALATE DEHYDROGENASE
    8e-23  27%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-22  28%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    1e-22  12%  2e37D  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-22  14%  1bdmA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    2e-22  18%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-22  28%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    2e-22  28%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    3e-22  25%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    5e-22  18%  1dhrA  [c.2.1 (1dirA)] DIHYDROPTERIDINE REDUCTASE
    6e-22  20%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    6e-22  16%  3c6cA  [x.x.x] 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME
    7e-22  16%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    9e-22  15%  3d7lA  [x.x.x] LIN1944 PROTEIN
    1e-21   6%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    1e-21  29%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-21  10%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    2e-21  29%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-21  30%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    4e-21  20%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    5e-21  10%  2e6gK  [x.x.x] 5'-NUCLEOTIDASE SURE
    7e-21  12%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    7e-21  32%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    8e-21  21%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-21  12%  1a9yA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    9e-21   8%  2a92C  [x.x.x] L-LACTATE DEHYDROGENASE
    9e-21  32%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    1e-20  15%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-20  12%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-20  31%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    2e-20  11%  1bxkB  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    3e-20  21%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    4e-20  25%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    5e-20   9%  3c2qA  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    1e-19  29%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-19  20%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-19  20%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-19  27%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-19  20%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    3e-19  17%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    4e-19  11%  1c9kB  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    4e-19  19%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-19  21%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-19  11%  3dxfB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    6e-19  13%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    8e-19  21%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    9e-19  21%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-18  12%  3c2qB  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    2e-18  23%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-18  12%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    2e-18  13%  2e37C  [x.x.x] L-LACTATE DEHYDROGENASE
    3e-18  31%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    3e-18  13%  2e37B  [x.x.x] L-LACTATE DEHYDROGENASE
    3e-18  20%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-18   8%  1c9yA  [c.78.1 - c.78.1] ORNITHINE CARBAMOYLTRANSFERASE
    6e-18  14%  3d7lD  [x.x.x] LIN1944 PROTEIN
    7e-18  14%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    1e-17  12%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-17  11%  3d64A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-17   8%  3d3uA  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    2e-17  19%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    2e-17  21%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-17  24%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    3e-17  21%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-17  21%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-17  26%  3e03A  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-17  12%  2e6hD  [x.x.x] 5'-NUCLEOTIDASE SURE
    4e-17  11%  2e6cC  [x.x.x] 5'-NUCLEOTIDASE SURE
    5e-17  16%  3d7lB  [x.x.x] LIN1944 PROTEIN
    5e-17  26%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    5e-17  12%  1bdmB  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    6e-17  21%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-17  17%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    6e-17  12%  2c5aB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    9e-17  21%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    1e-16  22%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    1e-16  17%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-16  16%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    1e-16  13%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    2e-16  21%  3bzuC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-16  31%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    5e-16  20%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-16  11%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    5e-16  20%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    5e-16  15%  3dfzA  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    6e-16  12%  1di6A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    6e-16  28%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    6e-16  10%  2e6hB  [x.x.x] 5'-NUCLEOTIDASE SURE
    9e-16  10%  2c54A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    1e-15  24%  1cydA  [c.2.1] CARBONYL REDUCTASE
    1e-15  23%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-15  21%  1e6wD  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-15  22%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-15  21%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-15  26%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    3e-15  16%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    3e-15  28%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    3e-15  26%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    3e-15  27%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    3e-15  12%  1cbuC  [c.37.1] ADENOSYLCOBINAMIDE KINASE/ADENOSYLCOBINAMIDE
    4e-15  11%  2c82A  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    4e-15  18%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-15  21%  3d4nA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-15   8%  3cq0B  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    5e-15  25%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    5e-15  21%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    5e-15  17%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-15  12%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    6e-15  14%  2e37A  [x.x.x] L-LACTATE DEHYDROGENASE
    6e-15  11%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    7e-15  25%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
    8e-15  23%  1e6wC  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    9e-15  18%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-14  10%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    1e-14  28%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    1e-14  27%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    1e-14  21%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-14  21%  1e3wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    2e-14  18%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    2e-14  17%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    2e-14  13%  2e6cD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-14  30%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    2e-14  26%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    2e-14  30%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    3e-14   8%  2a92B  [x.x.x] L-LACTATE DEHYDROGENASE
    3e-14  10%  3e6vA  [x.x.x] ARGINASE-1
    3e-14  25%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    4e-14  16%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    4e-14   9%  1d4gA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    4e-14  24%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    4e-14  16%  1a4uA  [c.2.1] ALCOHOL DEHYDROGENASE
    4e-14  23%  1bdbA  [x.x.x] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    5e-14  18%  1c14A  [c.2.1] ENOYL REDUCTASE
    5e-14   9%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    6e-14  10%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    6e-14  16%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    6e-14  13%  2e6bD  [x.x.x] 5'-NUCLEOTIDASE SURE
    8e-14  20%  3e9nB  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    8e-14  10%  2aw5A  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    9e-14  11%  1b3rA  [c.23.12 - c.2.1] PROTEIN (S-ADENOSYLHOMOCYSTEINE HYDROLASE)
    1e-13  26%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    1e-13  19%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    1e-13  15%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    2e-13  12%  1cg1A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    2e-13  27%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    2e-13  12%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    2e-13  25%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    2e-13  22%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    2e-13  25%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    3e-13  29%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    3e-13  29%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    4e-13  27%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    4e-13  13%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-13  16%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    5e-13  14%  3dhnA  [x.x.x] NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    6e-13  25%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    6e-13  21%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-13  19%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    7e-13  20%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    8e-13  25%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    8e-13  11%  3e5mB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    9e-13  12%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    9e-13  17%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-12  24%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    1e-12  25%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    1e-12  22%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    2e-12  26%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    2e-12  13%  2e6bC  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-12  28%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    3e-12  11%  1d4fA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    3e-12  27%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    3e-12  27%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    3e-12  28%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    3e-12  18%  3e9nE  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    3e-12  20%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    4e-12   9%  2a92A  [x.x.x] L-LACTATE DEHYDROGENASE
    4e-12  12%  2e6hC  [x.x.x] 5'-NUCLEOTIDASE SURE
    5e-12  10%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    5e-12  11%  1cg3A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    5e-12  22%  1e6wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    5e-12  11%  2bllA  [x.x.x] PROTEIN YFBG
    7e-12  12%  1edzA  [c.58.1 - c.2.1] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE
    7e-12  26%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    9e-12  17%  2e6gA  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-11  11%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    1e-11  11%  1buaB  [c.52.1] ENDONUCLEASE ECORV
    1e-11  25%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    1e-11   9%  1di7A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    2e-11  12%  1dj3A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    2e-11  27%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    2e-11   9%  1bw3A  [x.x.x] BARWIN, BASIC BARLEY SEED PROTEIN
    3e-11  25%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    3e-11  25%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    3e-11  19%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    4e-11  16%  3e9nD  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    4e-11   9%  3e5mA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    6e-11  16%  1adeA  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    6e-11  15%  2cukA  [x.x.x] GLYCERATE DEHYDROGENASE/GLYOXYLATE REDUCTASE
    6e-11  22%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    7e-11  12%  2a35A  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    9e-11  18%  3e9qB  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    9e-11  14%  2e6eD  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-10  13%  1cg4A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    1e-10  16%  3d7lF  [x.x.x] LIN1944 PROTEIN
    1e-10  26%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    1e-10  17%  3e9nH  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    2e-10  28%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    3e-10  15%  3d5tC  [x.x.x] MALATE DEHYDROGENASE
    3e-10  12%  3d3jA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    4e-10  17%  3e9nF  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    6e-10  25%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    7e-10  10%  2c5aA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    8e-10  12%  2e6eB  [x.x.x] 5'-NUCLEOTIDASE SURE
    9e-10   9%  3dtdB  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    1e-09  23%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    1e-09  12%  3dfzB  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    2e-09   8%  2eggA  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    2e-09  13%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    2e-09  10%  1a7aB  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    3e-09   9%  3dooA  [x.x.x] SHIKIMATE DEHYDROGENASE
    4e-09  12%  2e6gJ  [x.x.x] 5'-NUCLEOTIDASE SURE
    5e-09   9%  1a4iA  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    7e-09  15%  1a4iB  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    9e-09  34%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    9e-09  25%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    1e-08   7%  3donA  [x.x.x] SHIKIMATE DEHYDROGENASE
    2e-08  11%  2eezA  [x.x.x] ALANINE DEHYDROGENASE
    3e-08  25%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    3e-08  28%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    4e-08   7%  3bywC  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    4e-08  10%  2a35B  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    5e-08   8%  2bkaA  [x.x.x] TAT-INTERACTING PROTEIN TIP30
    6e-08  14%  3e8xA  [x.x.x] PUTATIVE NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    8e-08  10%  3bywB  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    1e-07  14%  1b0aA  [c.58.1 - c.2.1] PROTEIN (FOLD BIFUNCTIONAL PROTEIN)
    1e-07  12%  2e6gG  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-07  12%  3dqpA  [x.x.x] OXIDOREDUCTASE YLBE
    3e-07  12%  1civA  [c.2.1 - d.162.1] NADP-MALATE DEHYDROGENASE
    4e-07  10%  3bywF  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    4e-07  14%  1d0iA  [c.23.13] TYPE II 3-DEHYDROQUINATE HYDRATASE
    5e-07  16%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    8e-07  24%  1ek6B  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    1e-06  15%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    2e-06  14%  2ef0A  [x.x.x] ORNITHINE CARBAMOYLTRANSFERASE
    5e-06  26%  3eheA  [x.x.x] UDP-GLUCOSE 4-EPIMERASE (GALE-1)
    5e-06  14%  2e6gB  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-05  15%  1e7rA  [c.2.1] GDP-FUCOSE SYNTHETASE
    1e-05  12%  1a7aA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    2e-05   9%  1buaA  [c.52.1] ENDONUCLEASE ECORV
    3e-05  38%  2c29D  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    4e-05  27%  2b69A  [x.x.x] UDP-GLUCURONATE DECARBOXYLASE 1
    8e-05  12%  3bywD  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    1e-04  17%  1db3A  [c.2.1] GDP-MANNOSE 4,6-DEHYDRATASE
    1e-04  11%  1ddtA  [d.166.1 - f.1.2 - b.2.1 (1mdtA)] DIPHTHERIA TOXIN
    1e-04  23%  3d5tA  [x.x.x] MALATE DEHYDROGENASE
    2e-04  22%  1arzB  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-04  12%  3bywH  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    3e-04  11%  2e6gF  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-04  11%  1a2zA  [c.56.4] PYRROLIDONE CARBOXYL PEPTIDASE
    0.001   5%  3dtdA  [x.x.x] INVASION-ASSOCIATED PROTEIN B
:238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAERRTALVTGATKGIGLALSKHLQQLGWSVIGVARHAIEGFPGQLLTADLADIQQTDAVLAQVVAASRI
1a9zA           ------VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLRLGGKHPTFVEGDIRNEALMTEILHDHAIDTVI
1a27A           ----TVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDPGSLETLQLDVRDSKSVAAARERVTEG-RV
2belC           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARLELGAASAHYIAGTMEDMTFAEQFVAQAGKLGGL
1dj2A           ESELAKSFIGTTKRGIGPAYSSKVIRNGIRVGDLRHMLLLSDAAARFQGFKYTPEMLREEVEAYKRYARL
2ae1A           ----CTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVANHFKL
2d1yA           ----KGVLVTGGARGIGRAIAQAFAREGALVALCDLRPAEAIGGAFFQVDLEDERERVRFVEEAAYAGRV
1dohB           ----KVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTEGSDAACVKANVGVVEDIVRMFEEAVKIGKL
2d1yB           ----KGVLVTGGARGIGRAIAQAFAREGALVALCDLRVAEAIGGAFFQVDLEDERERVRFVEEAAYAGRV
3ce6B           ALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIKAKD
3deyX           ---RTVVLITGCSSGIGLHLAVRLASDPSQSFKVYARALACPPGSLETLQL-DVRDSKSVAAARVTEGRV
2a4kA           ----KTILVTGAASGIGRAALDLFAREGASLVAVDREAVAALEAEAIVADVSDPKAVEAVFAEALEEGRL
3ch6E           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLASAHYIAGTMEDMTFAEQFVAQAGKLMGL
2cfcA           ----RVAIVTGASSGNGLAIATRFLARGDRVAALDLSHAYADKVLRVRADVADEGDVNAAIAATMEQDVL
3d3eA           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETAASAHYIAGTMEDMTFAEQFVAQAGKLGGL
1bmdA           MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILEGVVMELEDCAFPLLAGLEATDDPDVAFKDAD
2cnbB           ----MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLPKPPWADRYAALEVGDVRNEDFLNGVFTRHPI
2ehdA           ---KGAVLITGASRGIGEATARLLHAKGYRVGLMARDRLQALAAELLPGDVREEGDWARAVAAMEEAFEL
2d1yC           ----KGVLVTGGARGIGRAIAQAFAREGALVALCDLRVAEAIGGAFFQVDLEDERERVRFVEEAAYAGRV
1c3vA           -------GVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLI
2d1yD           ----KGVLVTGGARGIGRAIAQAFAREGALVALCDLRVAEAIGGAFFQVDLEDERERVRFVEEAAYAGRV
3czrA           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSELGAASAHYIAGTMEDMTFAEQFVAQAGKLGGL
3d5qC           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGL
3ce6A           ALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPFDVVTVEEAIGDADIVVTATGNKDIIMLEHID
3bmoB           ----PAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNSNVLPASCEEIINSCRA
1dfiA           ----KRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKGSDIVLQCDVAEDASIDTMFAELGKVPKF
3dwfC           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGG
3d5qD           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQSAHYIAGTMEDMTFAEQFVAQAGKLGGL
3bzuB           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKLELGAASAHYGTMEDMTFAEQFVAQAGKLMGL
3ch6B           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLASAHYIAGTMEDMTFAEQFVAQAGKLMGL
3ctmF           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHLQKTYGVHSKAYKCNISDPKSVEE---TISQQ
2aw5B           ------TILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKGLIVKGQEKEKFAHEHEEMKNLEAIVQEKP
2ag5A           ----KVIILTAAAQGIGQAAALAFAREGAKVIATDINLEKYPGIQTRVLDVTKKKQIDQFANEV---ERL
2belA           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSELGAASAHYIAGTMEDMTFAEQFVAQAGKLGGL
3dwfA           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGG
2aw5C           ----DQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIIVKGQEKEKFAHEHEEMKNLEAIVQEKP
2belD           ----KKVIVTGASKGIGREMAYHVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKL
3d3wA           ----RRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERALGV
2ehdB           ---KGAVLITGASRGIGEATARLLHAKGYRVGLMARDRLQALAAELLPGDVREEGDWARAVAAMEEAFGE
2eghA           ----KQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKCLEFSPRYAVMDDEASAKLLKTMLQQQGST
3ctmH           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYAYKCNISDPKSVEETISQQ
3ce6D           ------KVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINVEEAIGDADIVVTATGNKDIIMLEHIKMKD
3e03C           ----KTLFITGASRGIGLAIALRAARDGANVAIAAKSAVAGGQGLALKCDIREEDQVRAAVAATVDTFGI
2dfdA           ----AKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGP---EQLP
2dknA           --------ITGSASGIGAALKELLARAGHTVIGIDRGQADIVAAVLDRCGGVLDGLVCCAGVGVTAANVV
2ag5C           ----KVIILTAAAQGIGQAAALAFAREGAKVIATDINLEKYPGIQTRVLDVTKKKQIDQFANEV---ERL
2e37D           -------GIVGSGVGSATAYALALLGVAREVVLVDLEDILHATPFAHPVWVRAGSYGDLEGARAVVVARL
1bdmA           MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILLEIPQAMKALEGVVMELEDCAFPLLAGLEATD
2b35A           ----KRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDRLRLPLLELDVQNEEHLASLAGRVTEAIGANKL
2b4qB           ----RIALVTGGSRGIGQMIAQGLLEAGARVFICARDLSAYGDCQAIPADLSSEAGARRLAQALGELSRL
2ag5B           ----KVIILTAAAQGIGQAAALAFAREGAKVIATDINLEKYPGIQTRVLDVTKKKQIDQFANEV---ERL
3e03B           ----KTLFITGASRGIGLAIALRAARDGANVAIAAKSAVAGGQGLALKCDIREEDQVRAAVAATVDTFGI
1dhrA           --EARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEESASVIVKMTDSFTEQADQVTAEVGKLKVD
3bhmA           ----HVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQPRFHQLDIDDLQSIRALRDFLRKEYGG
3c6cA           ----------------------------------------------------------------------
2b35E           ----KRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDRLRLPLLELDVQNEEHLASLAGRVTEAIGANKL
3d7lA           ----AKILLIGASGTLGSAVKERLEKKAEVITAGRHSGDV---------TVDITNI--DSIKKYEQVGKV
3e48A           -------ILTGATGHLGTHITNQAIANHIDHFHIGVPDDWRGKVSVRQLDYFNQESVEAFKGDTVVIPSI
1bhsA           ---RTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGTLQLDVRDSKSVAA-ARERVTEGRV
1b8pA           ----MRVAVTGAAGQICYSLLFRIANGDMLGKDQPVKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDA
3edmB           ----RTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVIKADLTNAAEVEAAISAAADKGEI
2ekpA           ----RKALVTGGSRGIGRAIAEALVARGYRVARNPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGL
3e9qA           ----RIILVTGASDGIGREAATYARYGATVILLGSHINEETGRQPQWFILDLLTCTSENCQQLAQRIVRL
2e6gK           ------------------------------ILVTNDDGIYSPGLWALAEAASQFGEVFVAAPDTITIAPV
2cnbC           ----MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHAALEVGDVRNEDFLNGVFTRHPI
1edoA           ----PVVVVTGASRGIGKAIALSLGKAGCKVLVNYARSAKAAEETFGGDVSKEADVEAMMKTAIDAWGTI
3bzuD           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARETLQKVVSHCLELGAASAFAEQFVAQAGKLMGGL
1a9yA           ------VLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSGKHPTFVEGDIRNEALMTEILHDHAIDTVI
2a92C           ----KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGDTSHSNVMAYSNCKVTGSNSYDDLKG
3csdB           ----EVALVTGATSGIGLEIARRLGKEGLRVFVCARLKELREAGVEADGRTCDVRSVPEIEALVAAVVPV
2e37E           -------GIVGSGVGSATAYALALLGVAREVVLVDLILHATPFAHPVWVRAGSYGDLEGARAVVLAATRL
2cnbA           ----MRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDPPWADRYAALEVGDVRNEDFLNGVFTRHGPIDVV
2ekqD           ----RKALVTGGSRGIGRAIAEALVARGYRVAIAPEEAAQSLGAVPLPTDLEKDDPKGLVKRALEALGGL
1bxkB           ----RKILITGGAGFIGSALVRYIINETSDAVVVVDKSLAPVAQSERFAFEKVDICDRAELARVFTEHQP
3ek2B           ----KRILLTGLLSNRSIAYGIAKACKREGAELAFTYAAEFGSELVFPCDVADDAQIDALFASLKTWDSL
3bmeC           ----PAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNNKERSNTAVVQADLTNSNVLPASCEEIINSRAF
3c2qA           -GPALAKVELGYIQAILAGNALATHDIESALYGTSLGVGGHKHHIYAINAINDAGNIKNAVESGVLKGIY
3edmA           ----RTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVIKADLTNAAEVEAAISAAADKFEI
3dwfB           ----KKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKLELGAASAHYIAGSMEDMTFAEEFVAEAGNLL
3dijA           ----RGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQR
2dknB           --------ITGSASGIGAALKELLARAGHTVIGIDRGSTPGGRETAVAAVLDRCGGVLDGLVCCAGVNGL
3ek2A           ----KRILLTGLLSNRSIAYGIAKKREGAELAFTYVGDRFKDRITEFACDVADDAQIDALFASLKTWDSL
2c29F           ----ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPKAETHLTLWKADLADEGSFDEAIKGCTVATPM
1c9kB           ------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQHHKDGRPAHWRTAECWRHLDTLITADLAPDDA
3d5qB           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKAASAHYIAGTMEDMTFAEQFVAQAGKL
2belB           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKCLELGAASAHYIAGTMEDMTFAEQFVAQAGGL
3dxfB           ---KKLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTANPKAAKELRLQGAEVVQGDQDDQVIMELALNGG
1e7qA           ---KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAK----
3ch6A           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKLGAASAHYIAGTMEDMTFAEQFVAQAGKLMGG
3d4nD           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTHCLELGAASAHYIAGTMEDTFAEQFVAQAGKLMGGL
3c2qB           ----LAKVELGYIQAILAGNALATHDIESALYGTSLGPVTGGHKHHIYAAINDAGNIKNAVESGVLKEIY
3diiA           ----RGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQR
1bxkA           ----RKILITGGAGFIGSALVRYIINETSDAVVVVDKLSLAPVAQSERFAFEKVDICDRAELARVFTEQP
2e37C           -------GIVGSGVGSATAYALALLGVAREVVLVDLILHATPFAHPVWVRAGSYGDLEGARAVVLAAGRL
2a4kB           ----KTILVTGAASGIGRAALDLFAREGASLVAVDREAVAALEAEAIVADVSDPKAVEAVFAEALEEGRL
2e37B           -------GIVGSGVGSATAYALALLGVAREVVLVDLEDILHATPFAHPVWVRAGSYGDLEGARAVGVARL
3ch6D           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVIAGTMEDMTFAEQFVAQAGKLMGGL
1c9yA           -----TLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGPDASVTKLAEQYAKENGTKLLLTNDPLEAAGG
3d7lD           ----AKILLIGASGTLGSAVKERLEKKAEVITAGRHSGDVTVD-----------ITNIDSIKKYEQVGKV
1bsvA           ---KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTR----DELNLLDSRAVHDFFASERIDQVYLAAAK
2c5eB           ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
3d64A           ----GKIAVVAGYGDVGKGCAQSLRGLGATVWVTEIDPICMEYAADKADIFVTATGNYHVINHDHMKAMR
3d3uA           -----VLPGSDLELRIGQNCASLIKDGDTLQLGIGGIPDAVLRALEGHKDLGIHTEMFTDGVMRMIRKII
2bd0A           ---KHILLITGAGKGIGRAIALEFARAARHHPDFEPVLVLSSRTAADLEKISLECRAEGALTDTITADIS
3ek2D           ----KRILLTGLLSNRSIAIAKACKREGAELAFTRITEFAAEFGSELVCDVADDAQIDALFASLKTHWDS
1ahhA           ----KCAIITGAGAGIGKEIAITFATAGASVVVSDINAQLGGQAFACRCDITSEQELSALADFAISKLGK
3d4nC           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKAASAHYIAGTMEDMTFAEQFGKLMGGL
3d4nB           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGMTFAEQFVAQAGKLMGGL
3e03A           ----KTLFITGASRGIGLAIALRAARDGANVAIAAKSAVAGGQGLALKCDIREEDQVRAAVAATVDFGGI
2e6hD           ------------------------------ILVTNDDGIYSPGLWALAEAASQFGEVFVAAPDTTIAHPV
2e6cC           ----------------------------------------------AAPDTEQSAAGHAITIAH----PV
3d7lB           -----KILLIGASGTLGSAVKERLEKKAEVITAGRHSGDVTVDITNIDSI-----------KKYEQVGKV
3bmfB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSERSNTAVVCQADLTNSNVLPASCEEIINSCFR
1bdmB           MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGEDCAFPLLAGLEATDDPD
3byzA           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVYIAGTMEDMTFAEQFVAQAGKLMGG
3ctmG           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGNISDPKSVEETISQQEKD
2c5aB           ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHLVDLRVMENCLKVTEGVDHVFNLAADMGG
2bgkA           ----KVAIITGGAGGIGETTAKLFVRYGAKVVIADIADGSPDVISFVHCDVTKDEDVRNLVDTTIAKGKL
1dohA           ----KVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKNVEDIVRMFEEAVKIFGKL
2b36B           ----KRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDRLKAPLLELDVQNEEHLASLAGRVTEAIGAGNK
1d7oA           ----KRAFIAGIANGYGWAVAKSLAAAGAEILVTSLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPED
1c9kA           ------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQIARIQHHKDGRPAHWRTAECWRLDTLITADLA
3bzuC           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKLGAASAHYIAGTMEDMTFAEQFVAQAGKLMGG
2dteA           ----KVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEAKYDHIECDVTNPDQVKASIDHIFKEYGI
3bzuA           MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSHCLELGAASAHYIAGTMEDMTFAAQAGKLMGGL
1e7sA           ---KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNL-----LDSRAVHDFFASERIDQYLAAAK
3ek2C           ----KRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDFGSELVFPCDVADDAQIDALFASLKTHWSL
3dfzA           ----RSVLVVGGG-TIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFFIN
1di6A           -------VSISDRDKGIPALEEWLTSALTTPFELETRLIP-----------DEQAIIEQTLCELVDEMSC
2c07A           ----KVALVTGAGRGIGREIAKMLAKSVSHVICISRTQFGYESSGYAGDVSKKEEISEVINKILTEHKNV
2e6hB           ------------------------------ILVTNDDGIYSPGLWALAEAASQFGEVFVAAPDHAITIPV
2c54A           ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKKEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
1cydA           ----LRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECPGIEDLGDWDATEKALGGIGPV
3edmC           ----RTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAATAVIKADLTNAAEVEAAISAAADKGEI
1e6wD           ----LVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCILTLAKEKFGRIDVAVNC
1e3sA           ----LVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCALTLAKEKFGRIDVAVNC
3d3eB           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGG
3bmnD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVL
2aqkA           ----KRILVSGIISSIAFHIARVAQEQGAQLVLTGFDRLRLIQRIQNEEHLASLAGRVTEAIGAGNKLDG
2c7vD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLLTNSNVLPASCEEIINSCFRAFGRC
3cxrA           ----KIALVTGASYGIGFAIASAYNQELVDRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESEVGII
1ae1A           ----TTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEGSVCDLLSRTERDK
1cbuC           ------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILDDEMAARIQTAECWRHLDTLITADLAPDDA
2c82A           ---RLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAARQRAQTGVTNIAVADEHAAQRVGDIPYHSDAA
2aqhA           ----KRILVSGIISSVAFHIARVAQEQGAQLVLTGFDRLRLILLELDVQNEEHLASLAGRVTEAIGAGNK
3d4nA           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGG
3cq0B           ----AASKLEKYARFIDAAVEYGRKHGKTDHEKIENTQILKVVPGRVSVDARLSFDKKATVKKALHIIYK
3bmqA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVL
1e6wB           ----LVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVKFGRIDVAVNC
2b35C           ----KRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDRAKAPLLELDVQNEEHLASLAGRVTEAIGAGNK
2c54B           --ENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
2e37A           -------GIVGSGVGSATAYALALLGVAREVVLVDLDRILHATPFAVWVRAGSYGDLEGARAVVLAAGRL
1ek5A           ----EKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRLTGRSVEFEEMDILDQGALQRLFKKYSF
3edmD           ----RTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAEGAATAVAIKADLTNAAEVEAAISAAADKFEI
1e6wC           ----LVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGVQAALTLAKEKFGRIDVAVNC
2aqiA           ----KRILVSGIDSSIAFHIARVAQEQGAQLVLTGFDRLLPAKAPLLELDVQNEEHLASLAGRVTEAIKL
2axqA           ----KNVLLLGSG-FVAQPVIDTLAANDDINVTVACRTLANAQALAKPSGSKAISLDVTDSALDKVLADN
2b4qA           ----RIALVTGGSRGIGQMIAQGLLEAGARVFICARDACADTATRLSAYGDCQAIPADLSSEAGARRLAQ
2ae2A           ----CTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWCDLSSRSERQELMNTVANHFHG
3d5qA           ----KKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFGL
1e3wA           ----LVAVITGGASGLGLSTAKRLVGQGATAVLLDVCIFAPANVTSEKEVQAALTLAKEKFGRIDVAVNC
3e9nC           ----KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLK
2aq8A           ----KRILVSGIISSIAFHIARVAQEQGAQLVLTGFDRLKAPLLELDVQNEEHLASLAGRVTEAIGAGNK
2e6cD           -------------------------------------AASQFGEVFVAAPDTHAITIAHPVRAYPHPSPL
2c7vA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAKERSNTAVVQADLTNSNVLPASFRAFGRC
3bmiB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNASCEEIINSCFRAFGRC
2c7vB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAERSNTAVVQADLTNASCEEIINSCFRAFGRC
2a92B           ----KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGDVV
3e6vA           KKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDITTTSGNLHGQPVSFLLKELKGKIPDVGF
3bmnB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVL
2b37C           ----KRILVSGIISSIAFHIARVAQEQGAQLVLTGFDRLKAPLLELDVQNEEHLASLAGRVTEAIGAGNK
1d4gA           ------------------------------------------------NIFVTTTGCVDIILGRHFEQMD
3bmfC           --EAPAAVVTGAAKRIGRAIAVHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIICFRAF
1a4uA           ----KNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAES
1bdbA           ----EAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSLEDQKQAAS
1c14A           ----KRILVTGVASKLSIAYGIAQAMHREGAELAFTYQAQLGSDIVLQCDVAEDASIDTMFAELGKVWKF
2c59B           ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKKEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
2c59A           ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKKEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
3ctmB           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEE
2e6bD           ------------------------------------------------APDTHAITIAHPVRAYPHPSPL
3e9nB           ----KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLK
2aw5A           ------TILFQGAGEAALGIAHLIVMALEKEGLPKEKSKGLIVKGQEKEKFAHEHEEMKNLEAIVQEIKP
1b3rA           --IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINMDEACKEGNIFVTTTGCVDIILGRHFEMKD
2bfaA           ------ALVTGAAKRLGRSIAEGLHAEGRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRC
3ctmE           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEYGVHSKAYKCNISDPKSVEETISQQEKD
3ctmC           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAPKSVEETISQQEK
1cg1A           EKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEV-MEYHNFQLVNYYKAEAVDYQKV
1e7wB           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATA
1bwsA           ---KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAK----
2bf7A           ------ALVTGAAKRLGRSIAEGLHAEGRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRC
1cwuA           ----KRAFIAGIDNGYGWAVAKSLAAAGAEILVGTWV---------------------------------
3bmdB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNSNVLPASCEEIINSCFR
3bmqC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNSNVLPASCEEFRAFGRC
2c7vC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAERSNTAVVQADLTNSNVLPASCEEFRAFGRC
1ae1B           ----TTALVTGGSKGIGYAIVERNEKELDECLEIWREKGLNVEGSVCDLLSRTERDKLMQTVAHVFDGKL
2c5eA           ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHHLVDLRVMENCLKVTEGVDHVFNLAADMG
3ctmD           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVEE
3dhnA           ----KKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPEKIKIENEHLKVKKADVSSLDE----------
3bmeA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAERSNTAVVQADLTNSNVLPASCEEIINSCFR
2b35B           ----KRILVSGIDSSIAFHIARVAQEQGAQLVLTGFDRLRLAKAPLLELDVQNEEHLASLAGRIGAGNKL
2b37B           ----KRILVSGIDSSIAFHIARVAQEQGAQLVLTGFDRLRLIKAPLLELDVQNEEHLASLAGRVTEAIGA
2b35F           ----KRILVSGTDSSIAFHIARVAQEQGAQLVLTGFDRLRLAKAPLLELDVQNEEHLASLAGRIGAGNKL
3bmfD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADEADLTNSNVLPASCEEIINSCFR
3e5mB           ---KKLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGADQDDQVIMELALNGAYAT
2c20A           -----SILICGGAGYIGSHAVKKLVDEGLSVVVVDNLQTGHEDAITEGAKFYNGDLRDKAFLRDVFTQEN
2b35D           ----KRILVSGIDSSIAFHIARVAQEQGAQLVLTGFDRLRLAKAPLLELDVQNEEHLASLAIGAGNKLDG
3bmoA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNCEEIINSCFRAFGRCDV
2bfmB           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATA
3bmfA           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELDLTNSNVLPASCEEIINSCFR
1e92A           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANVATAPAPVTLFTRCAELVAACYTHWGR
2e6bC           ---------------------------------LAEAASQFGEVFVAAPDTHAITIA-HPVRAYPHPSPL
3bmoD           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNASCEEIINSCFRAFGRC
1d4fA           --IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIEPINALQAAMEGYEVTTMDEACKEGNIFVTTTGC
3bmoC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNSNVLPASCEEFRAFGRC
2bfoC           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSHWGRC
3bmnC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAESNTAVVCQADLTNSNVLPASCEEFRAFGRC
3e9nE           ----KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEE-----GG
3e9nA           ----KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEG-----VEPIESDIVKEVLEEGG
2a92A           ----KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDQGKALDTSHSNVMAYSNCKVTGSSYDDLKGADVV
2e6hC           -------------------------------------AASQFGEVFVAAPDGHAITIAHPVRAYP---HP
3dxfA           ---KKLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTARKKAAKELRLQGAEVVQGDQDDQVIMELALNGA
1cg3A           EKARGAKAIGTTGRGIGPAYEDKVALRGLRVGDLFDKETFAEK---LKEVMEYHNFQLVNYYKAEAVDYQ
1e6wA           ----LVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETETSEKEVQAALTLAKEKFGRIDVAVNC
2bllA           -------LILGVNGFIGNHLTERLLREDHYEVYGLDRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLP
1edzA           ----KKCIVINRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGLKLNKHHVEDLGEYSEDLLKKCSLD
2bfoA           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAANVATAPVAPVTLFTRCAELVAACYTHWGRC
2e6gA           -------------------------------------------------FVAAPDAHPVRAYPHPSPAPH
3c3xA           ---KSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNKTTLLDEFQSLGAIIVKGELDEHEKLVELKKV
1buaB           ----------------------------------------------------------------------
3bmkC           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEANTAVVCQADLTNSNVLPASCEEIINSCFR
1di7A           -----VSISDRYQDKGIPALEEWLTSALTTPFELET-----------RLIPDEQAIIEQTLCELVDEMSC
1dj3A           EAELANSFIGTTKRGIGPCYSSKVTRNGLRVCDLRHMDTFGDKLDVLFERFEGFKYSKGMLKEEVERYKK
2bfaD           ------ALVTGAAKRLGRSIAEGLHAEGYAPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTWGRC
1bw3A           ATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSGPAGPRGQAACGKCLRVTNPATGAQITARIVDQCGL
2bfpB           ----PVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATA
3cxtA           ----KIALVTGASYGIGFAIASAYAKAGATIVFNRGMAAYKAAGINAHGYVCDVTDEDGIQAMVAQIESE
3ctmA           ----KVASVTGSSGGIGWAVAEAYAQAGADVAIWKAEHLQKTYGVHSKAYKCNISDPKSVEETISQQGTI
3e9nD           ----KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGG----V
3e5mA           ----KLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTKAAKELRLQGAEVVQGDQDDQVIMELALNGAYAT
1adeA           EKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKYHNFQLVNYYKAEAVDYQKVLDDTMAVADILVD
2cukA           --------------RIGQAVAKRALAFGMRVVYHARTPELLKEADVVSLHTPLTPETHRLLNRERLFAKR
2bfaB           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARAELVAACYTHWGRCDVLV
2a35A           ----KRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKALAE-----------HPRLDNPVGPLAELLP
3e9qB           ----RIILVTGASDGIGREAATYARYGATVILLGSHINEETGRQPQWFILDLLTCTSENCQQLAQRIVVN
2e6eD           ----------------------------------------------AAPDIAHPVRAYPHPPHFPAYTPA
1cg4A           EKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKEHNFQLVNYYKAEAVDYQKVLDDTMAVADILTD
3d7lF           -------LLIGASGTLGSAVKERLEKKAEVITAGRHSGDVTVDITNIDSIKKYEQVGK-----------V
1e7wA           ----PVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSNVATAPVSSAPVTLFTRCAELVAACYTHWGRC
3e9nH           ----KIAVVTGATGGMGIEIVKDLSRDHIVYALGRNPEHLAALAEIEGVEPIESDIVKEVLEEGGVDKLK
3bmeB           --EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEASNTAVVQADLTNSNVLPASCEEFRAFGRC
3d5tC           --PAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVIL------QLL-----DLPQAQAAVKGVVMELDD
3d3jA           ---------PHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKQGQQVSSLKDLPTSPV
3e9nF           ----KIAVVTGATGGMGIEIVKDLSRDHIVYALGRPEHLAALAEIEGVEPIESDIVKEVLEEG-----GV
1e92C           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGR
2c5aA           ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKDEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
2e6eB           ----------------------------------LWALAEAASQFGEVFVAAPDTTIAHPVRAYPHPSPH
3dtdB           ---------------------------LWSINCGIQEG--KKVCFMHRQEVNDQNRVVVAMSVVLNADVP
2bf7B           ----PVALVTGAAKRLGRSIAEATLNARRPNSAITVQADLSNVATAPSAPVTLFTRCAELVAACYTHWGR
3dfzB           ----RSVLVVGGG-TIATRRIKGFLQEGAAITVVAPTQLRVKRKKVGEEDLLNVFFIVVATNDQAVKIKN
2eggA           ----------------------------------------------------------------------
1e6uA           ----QRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAK----
1a7aB           ----GKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINEVTTDEACQEGNIFVTTTGCIDIILGRHDD
3dooA           ----------------------------------------------------------------------
2e6gJ           ------------------------------------------------ALAEAASQFGEVFVAAPDAHPV
1a4iA           ----RHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAATGQPEMVKGEWIKPGAIVIDCGINYKVVDV
1a4iB           ----RHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKT----AHLDEEVNKGDILVVATGQPEMVKGEWI
1e92B           ----------------------------------------------------------------------
2bfaC           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATA
3donA           ----------------------------------------------------------------------
2eezA           -----SVVILGGG-TVGTNAAKIALGMGAQVTILDVNHLDDVFGGRVITLTATEANIKKSVQHADLLIAV
2bfmC           ------ALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRDLSNVATAAPVTLFTRCAELVAACYTHWGRCDV
2bf7C           ----PVALVTGAAKRLGRSIAEGLHAEGRPNSAITVQADLSNVATAPAPVTLFTRCAELVAACYTHWGRC
3bywC           ----DLILGTLPANSEDAGARGLFVRANDDGLQITSHGELVADATIAISATEDETTAGIEGDDSTTETPI
2a35B           ----KRVLLAGATGLTGEHLLDRILSEPTLAKVIAPA---------------RKALAEHPRLDNPVGPLA
2bkaA           ----KSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASFQGH
3e8xA           ------VLVVGANGKVARYLLSELKNKGHEPVAVRNEEQGPELRERGASDIVVANLEEDF----------
3bywB           -KDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHAQLPADATIAISATEDETTAGIEGDDSTTETVE
1b0aA           ----LNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLVAVGKPGFIPGDWIKEGAIVIDVGINRKV
2e6gG           ----------------------------------------------APDTITIAHPVRAYPHPSPLHAPH
3dqpA           -------FIVGSTGRVGKSLLKSLSTTDYQIYAGARKVEQVPQYN--------------------NVKAV
1civA           ----INVAVSGAAGMISNHLLFKLASGEVFGPDQPIALEGVAMELEDSLYPLLRQVSIGIDPYEIFQDAE
3bywF           -KDQDLILGTLPANSEDAGARGLFVRANDDGLQITSHAQLPADATIAISATEDETTAGIEGDDSTTETVE
1d0iA           LANAPIMILNGPNLNL-------LGQRQPEIYGSDTLAVKAAAAHGGTVDFRQSNHEGELVDWIHEANHC
3e48B           -------ILTGATGHLGTHITNQAIANHIDHFHIGVR--NVEKVPDDWRGKVSVRQLDYFNQESVEAFKG
1ek6B           ----EKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNF---------------------------------
2dt8A           ----RITLVTDSTSDLPQDL---RGRLGVRVVPLYVNLSGREGAAFPTTSQPSPEDFARVYREALEEDHV
2ef0A           ----LEVAWVGDGNNVLNSLLEVAPLAGLKVRVATPKGYEPDPAFFTHDPKEAALGAHALYTDVWTEKRQ
3eheA           ------IVVTGGAGFIGSHVVDKLSESNE-----------------------------------------
2e6gB           ---------------------------------------------------PIAHPVRAYPHPSPLHAPH
1e7rA           ---KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGI
1a7aA           ----------------------------------------------------------------------
1buaA           ----YNINELNEIPKPYKGVKVFLQDKWVIAGDLAGSSIHAHYKDFVEGFDSEDEFLDYWRNYERTSQLR
2c29D           -----TVCVTGASGFIGSWLVMRLLERGYTVRATVRD---------------------------------
2b69A           ---RKRILITGGAGFVGSHLTDKLDGHEVTVVD-------------------------------------
3bywD           --DQDLILGTLPANSEDAGARGLFVRANDDGLQITSHAQLPADATIAISATED--ETTAGIEGDDSTETV
1db3A           ----KVALITGVTGQDGSYLAEFLLEKGYEVHGIKRPKFHLHYGDLSDTSNLTRILREVQPDEVYNLGAM
1ddtA           ----------------------------------------------------------------------
3d5tA           --PAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQPVIL------QLL-----DLPQAQAAVKGVVMELDD
1arzB           -----RVAIAGAGGRMGRQLIQAALALEGVQLGAALE---------------------------------
3bywH           --DQDLILGTLPANSEDAGARGLFVRANDDGLQITSHAQLPADATIAISATED--ETTAGIEGDDSTETV
2e6gF           ---------------------------------------------------PDTTIAHPV-RAYPHPSPL
1a2zA           ----KKVLITGFEPFGGDSKNPTEQI-----AKYFDRKQIGNAMVYGRVLPVSVKRATIELKRYLEEIKP
3dtdA           ------------------------------------------NRVVVAMSVVLNADGVVSGNLTVPF---


                         .         .         *         .         .         .         .:140
query           DAVINNAGIALPQKLESLDLPSLQTVFDLNVRAAVQVTQACLPSLKQSPAGRIVNVCSRAIHGARDRTSY
1a9zA           HFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDNPKIPYVEFPTGTPQSPF
1a27A           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGLMGLPFNDVY
2belC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1dj2A           EPYITDTVHFINDSISQKK-----KVLVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLGIAPSVGDLI
2ae1A           NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISSSGALAVPYEAVY
2d1yA           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQLFAEQENAAY
1dohB           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
2d1yB           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASQGLFAEQENAAY
3ce6B           HAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHQIELWTKN
3deyX           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLGLPFNDVY
2a4kA           HGVAHFAGVAHSALPLEAW----EKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGL--GAFGLAHY
3ch6E           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2cfcA           VNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASASLVAFPGRSAY
3d3eA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1bmdA           YALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAKNAPGLNPRNFT
2cnbB           DAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTAEIDINAKKSPE
2ehdA           SALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGLAGKNPFKGGAAY
2d1yC           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQNAAY
1c3vA           HAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIEHHPHKADAPS
2d1yD           DVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGFAEQENAAY
3czrA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3d5qC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3ce6A           HAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATGHPSFLWTKN
3bmoB           FGRCDVLVNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLY
1dfiA           DGFVHSIGFAPGDQLDGDYVNAVTREGAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAEAIPNYNVM
3dwfC           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPY
3d5qD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3bzuB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3ch6B           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3ctmF           EKDFGTIDVFVANAGVTWTQGPENKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISIVNIPQLQAP
2aw5B           TALIGVAAIGGAFSLKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFPVTLPNGQTL
2ag5A           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
2belA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3dwfA           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPY
2aw5C           TALIGVAAIGGAFSEQILKDMAERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPYVFPGVALGVV
2belD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3d3wA           DLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARLIARGVPGAIVNVSSQSQRAVTNHSVY
2ehdB           LSALNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGTIVNVGSAGKNPFKGGAAY
2eghA           EVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQL
3ctmH           EKDFGTIDVFVANAGVTWTQGPEIKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSIKIVNIPQLQAP
3ce6D           HAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGRLLNLGNATIAQIELWTKN
3e03C           DILVNNASAIWLRGTLDTPKR--FDLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPPSLNPAWGAHT
2dfdA           DCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNKKHGVYNPNKIF
2dknA           AVNYFGVSALLDGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGDEARAIELAEQQGQTHLAY
2ag5C           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
2e37D           QLLDRNAQVFAQVVPRVLEAAPLVATNPVDVTQVAYRLSGLPPGRVVGS-GTILDTARFRALAEYLRVAP
1bdmA           DPDVAFKDADYALLVGAAPLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAKNAPGLNPRNFT
2b35A           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASKALLPIMNPGGSIVGMDFDPSRAMAYNWM
2b4qB           DILVNNAGTSPVSGWEKVM----QLNVTSVFSCIQQLLPLLRRSASAENPARVINIGSGISAMGEQAYAY
2ag5B           DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
3e03B           DILVNNASAIWLRGTLDTP--KRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPSLNPAWWGAHT
1dhrA           AILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLK---EGGLLTLAKAALDGTPGMIGY
3bhmA           DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG--RVVNVSSIMSVALKSCSPE
3c6cA           ------------------------------LRAARRQELGIKPELEVFSPGDILFGEEGLIDGVPLFQVL
2b35E           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAYNWM
3d7lA           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDK--GSFTLTTGIEDPIV----QG
3e48A           IHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFGYASRLLSTSGIDYTYVAYDPLKPY
1bhsA           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGVGGLMGLPFNDVY
1b8pA           DVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRIKVLVVGNPANTNAYIAKSAPSLPAKNFT
3edmB           HGLVHVAGGLIARKIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAY
2ekpA           HVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFITTFTAGGPVPIPAY
3e9qA           DGVLHNAGLLGDVCPSEQNPQVWQDVQINVNATFL--TQALLPLLLKSDAGSLVFTSS--SVGRQGRANW
2e6gK           RAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLG--HEIWHSGTVAAAKQGYLFGS
2cnbC           DAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTAEPIDINAKKSE
1edoA           DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGIGNIGQANY
3bzuD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1a9yA           HFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIYVESFPTGTPQSPF
2a92C           ADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNTNPVDVMVQLLEHSGVPKNKIIG
3csdB           DVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGTGRIVNIGGKQGVVHAAPY
2e37E           QLLDRNAQVFAQVVPRVLEAPEAVLLVATNPVDVTQVAYRLSGLPPGRGSGTILDTARRALLAEYLRVAP
2cnbA           HMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGNPTNAEPIDINAKKSPESY
2ekqD           HVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTGGPVPIPAY
1bxkB           DCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISTDEVYHSTDDFF
3ek2B           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALALPMLSDDASLLTLYLGAERAIPNYNTM
3bmeC           GRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLY
3c2qA           QCIKNNIPYVLAGSIRDDGP---IPDVITDSVAQDKRTTVDKKVILSTLLHSVATGNL-----------P
3edmA           HGLVHVAGGLIRKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAY
3dwfB           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPY
3dijA           IDVLVNNACGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAY
2dknB           VVAVNYFGVSALLDAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGDEARAIELAEQQGQTHLAY
3ek2A           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALAKAMLSDDASLLTLSYLGERAIPNYNTM
2c29F           DFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCSDMEFCRAKKMT
1c9kB           ILLECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVP---E
3d5qB           MGGILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2belB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3dxfB           KLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVEEYFRDIGVPMTSVRLPCYFENLSHFLP
1e7qA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQPMASELLQGTLEPTNEPY
3ch6A           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3d4nD           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3c2qB           QCIKNNIPYVLAGSIRDDGPIP---DVITDSVAQDKRTTVDKKVI-----------LSTLLHSVATGNLP
3diiA           IDVLVNNACGSKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAY
1bxkA           DCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAFRFHHISVYGDLHSTDDFF
2e37C           QLLDRNAQVFAQVVPRVLEAPEAVLLVATNPVDVTQVAYRLSGLPPGRVVGSGTILDTARFRALLSVHAY
2a4kB           HGVAHFAGVAWEKV------------LRVNLTGSFLVARKAGEVLE--EGGSLV----------------
2e37B           QLLDRNAQVFAQVVPRVLEAPEAVLLVATNPVDVTQVAYRLSGLPGRVVGSGTILDTARFRALLAEYLRV
3ch6D           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1c9yA           NVLITDTWISMGREEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSL---VF
3d7lD           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDKGSFTLTTGIEDP------IVQG
1bsvA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGLEPTNEPY
2c5eB           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
3d64A           HNAIVCNIG--HFDSEIDVASTRQYQWENIKPQVDHIIFPDGKRVILLAEGRLVNLGCATGHPSFVMSNL
3d3uA           NGKKKTLHPEKVVTSLIFGSKELYDFVNNNPVIECYPVDYINNPDVIGKNDRMVSINSCLEMDLMGQVDF
2bd0A           DMAVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFISVAATKAFRHSSIY
3ek2D           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALALPMLSDDASLLTLSYLGAEAIPNYNTM
1ahhA           VDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTTSMAAENKNINMTSY
3d4nC           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3d4nB           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3e03A           DILVNNASAIWLRGTLDTP--KRFDLQQVNARGSFVCAQACLPHLLQAPNPHILTLPPPSLNPAWWGAHT
2e6hD           RAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNGSNLGHEIWHSGTAAAKQGYLFGLS
2e6cC           RAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHSGTVAAAKQGYLFG
3d7lB           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDKG--SFTLTTG--IEDPIVQGAS
3bmfB           AFGRCDVLVASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLY
1bdmB           VAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKNPANTNALIAYKNAPGLNPRNFT
3byzA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3ctmG           FGTIDVFVANAGVTWTVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSIS-GKIQLQAPY
2c5aB           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAF
2bgkA           DIMFGNVGVLSTTSILEAGNEDFKRVMDINVYGAFLVAKAARVMIPAKKGSIVFTASISSFTAEGVSHVY
1dohA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
2b36B           LDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPVGMDFDPSRAMPAYNWM
1d7oA           DILVHSLANGPEVSKPLLETSRKGYLAAISASSYVSLLSHFLPIMNPGG-ASISLTYIASERIPGYGGGM
1c9kA           PDDAILLECITTMVTNLLFALDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNVGMGIVPENRLA
3bzuC           LDMLINHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
2dteA           SVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASITKNASAY
3bzuA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1e7sA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELQGTLEPTNEPY
3ek2C           DGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDIFPALAKAALPMLSDDASLLTLSYLGAERAIPNYNTM
3dfzA           DQLVNMDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQYTQFLYECVLIHRLNVSK
1di6A           HLVLTTGGTGPARRDVTPD--ATLAVADREMPGFGEQMRQISL--HFVPTAILSRQVGVIRKQALILNLP
2c07A           DILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVLTGNVGQANY
2e6hB           RAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLG--HEIWHSGTVAAAQGYLFGLS
2c54A           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
1cydA           DLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVATFPNLITY
3edmC           HGLVHVAGGLIARKTAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAY
1e6wD           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVAAFEGQVGQAAY
1e3sA           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIAFEGQVGQAAY
3d3eB           LDMLINHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3bmnD           PASCEEIINSCPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPCMAFSY
2aqkA           VVHAIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSAMPAYNWM
2c7vD           DVLVNNASAFYPTPLVQGDHNGKTVETQVAELIGTNAIMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
3cxrA           DILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINISMMSELGRETVSAY
1ae1A           LMQTVNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSIAGFSALPSVSLY
1cbuC           ILLECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGI---VPE
2c82A           TRLVEQTEADVVLNALVGALGLRPTLAALKTGARLALANKESLVAGDSEHSALAQCLRGGTPDEVAKLVL
2aqhA           LDGVVHSIGFMPGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWM
3d4nA           LDMLINHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
3cq0B           DAGVPKERVLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVTISPFVGRIMDFYKAYT
3bmqA           PASCEEAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
1e6wB           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVIINTASVGQAAY
2b35C           LDVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMNWM
2c54B           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
2e37A           QLLDRNAQVFAQVVPRVLEAPEAVLLVATNPVDVTQVAYRLSGLPPGRVVGSGTILDTARFRALLAQSVH
1ek5A           MAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGY
3edmD           HGLVHVAGGIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIVTFSSQAGRDGGGPGALAY
1e6wC           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVAAFEGQVGQAAY
2aqiA           DGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLMNPGGSIVGMDFDSRAMPAYNWM
2axqA           DVVISLIPYTFHPNVVKSAIRTKTDVVTSSYISPALRELEP-----EIVKAGITVMNEIGLDPGIDHLYV
2b4qA           ALGVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAENPARVINIGAMGEQAYAY
2ae2A           KLNILNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISVSGALAVPYEAVY
3d5qA           DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAY
1e3wA           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQINTASVAAFEGQVGQAAY
3e9nC           NLDHVD-----TLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAAS-GCVIYINNTIYAASKHAL--
2aq8A           LDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPVGMDFDPSRAMPAYNWM
2e6cD           HAPHFPAYRVRGTPADCVAL---GLHLFGPVDLVL-----SGVNLGSNLGHEIWHSGTVAAKQGYLFGLS
2c7vA           DVLVNNASAFYPTPLVQGKTVETAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLY
3bmiB           DVLVNNASAFYPTPLVGKTVETVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMV-DQPCMAFSLY
2c7vB           DVLVNNASAFYPTPLVQNGKTVETQVAETNAIAPFLLTMSFAQRQKTSSNLSIVNLCDAMVDQPMAFSLY
2a92B           IVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQEHSGVPKNKIIG
3e6vA           SWVTPCISAKDIVYIGLRDVNKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPAT
3bmnB           PVLVNNASAFYPTPLVQNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSNLSIVNLCDVDQPCMAFSLY
2b37C           LDGVVHIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLMNPGGSIVGMDFDPSRAMPAYNM
1d4gA           DAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSL
3bmfC           GRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLY
1a4uA           KKLLKDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSTGFNAIHQVPVY
1bdbA           RCVARDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
1c14A           DGFVHSIGFADGDYVNAVTREGFKIAHDISSYSFVAMAKACRS--MLNPGSALLTLSYLGAERAIPNYNM
2c59B           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
2c59A           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
3ctmB           TISQQEKDFGTIDVFVANAGVTWTQGPEIDLNGVYYCSHNIGKIFKKNGKGSLIITSSISGKIVNLQAPY
2e6bD           HAPHFPAYRVRGTPADCVALGLHL---------FGPVDLVLSGVNLGSNLGHEIWHSGTAAKQGYLFGLS
3e9nB           NLDHVDTLVHAASV------AEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTI----------Y
2aw5A           TALIGVAAIGGAFSEQILKDMAAFNERPALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVT-----L
1b3rA           DAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLAEGRLVNLGCAMGHPSFVMSNSF
2bfaA           DVLVNNASSFYPTPLLRDREAMETATADLNAIAPYFLIKAFAHRVAGTPAKHRGTNYSITNQPLLGYTIY
3ctmE           DVFVANAGVTWTDNYDSWN-----KIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSS-ISGKIQLQAPY
3ctmC           DFGTIDVFVANAGVTWVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGSLIITSSISGKIQLAPYNT
1cg1A           LDDILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSLGPRYVDYVL
1e7wB           DVLVNNASSFYPTPLLRGMETATADLFGSNAIAPFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTY
1bwsA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLGTLEPTNEPY
2bf7A           DVLVNNASSFYPTPLLGDREAMETATADLFGSNAIAPYFLIKAFAHRTNYSIINMVDAMTNQPLLGYTIY
1cwuA           --------------------------------------------------------IASERIIPGYGGGM
3bmdB           AFGRCDVLVASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDPCMAFSLY
3bmqC           DVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDPCMAFSLY
2c7vC           DVLVNNASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNIVNLCDAMVDQPMAFSLY
1ae1B           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFALPSVSLY
2c5eA           GMGIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
3ctmD           TISQQEKDFGTIDVFVANAGVTWTQGPEIDLNGVYYCSHNIGKIFKKNGKGSLIITSSKIVNIPQLQAPY
3dhnA           ----VCEVCKGADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLVGGAGSLFIAPGLRLDGEVPENIL
3bmeA           AFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFQSNLSIVNLCDAMVDQPMAFSLY
2b35B           DGVVHSIPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWM
2b37B           GIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPS--RAMPAYNWM
2b35F           DGVVHSIPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWM
3bmfD           AFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRLSIVNLCDAMVDQPMAFSLY
3e5mB           FIVTNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIK----------------KLTAGRLAAAH
2c20A           IEAVMHFAADSLVGVSMEKPLQYYNNNVYGALCLLEVMDEFKVDSTAATYGEVDVDLITEETMTNPTNTY
2b35D           VVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVGMDDPSRAMPAYNWM
3bmoA           LVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTSSNLSIVNLCDAMPCMAFSLY
2bfmB           PVAPNNASSFYPTPLLRNREAMETALFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSITNQPLLGYTIY
3bmfA           AFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAILLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSL
1e92A           CDVLVNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTVDAMTNQPLLGYTIY
2e6bC           HAPHFPAYRVRGTP---------ADCVALGLHLFGPVDLVLSGVNLGSNLGHEIWHTVAAAKQGYLFGLS
3bmoD           DVLVNNASAFYPTPLVGKTVEQVAELIGTNAIAPFLLTMSFAQRQKGSNLSIVNLCDAMVDQPCMAFSLY
1d4fA           VDIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLCAMGHPSFVMSNSFTNQVMAQIE
3bmoC           DVLVNNASAFYPTPLVQGKTVETQVAELIGTNAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLY
2bfoC           DVLVNNASSFYPTPLLRDREAMETATADLFGSNAIAPYFLIKAFARGTNYSIINMVDAMTNQPLLGYTIY
3bmnC           DVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSY
3e9nE           VDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINGNTIYAASKHAL--
3e9nA           VDKLKNLDHVDTLVHAAGSVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINNTIYAASKHAL---
2a92A           IVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFVTNPVDVMVQLLFEHSGVPKNKIIG
2e6hC           SPLHAPHFPAYRVRGTPADCVALGLHLFGPV------DLVLSGVNLGSNLGHEIWHTVAAAKQGYLFGLS
3dxfA           YATFIVTNYWECSQEQEVKQGKLLADLARRLGLHYVVYSGL--------------ENIKKLTAGRLAAAH
1cg3A           KADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSLGPRYVDYVL
1e6wA           AGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQGGQRGVAAFEGQVGQAAY
2bllA           LVAIATPIEYTRNPLRVFELDFEENLRIIRYRKRIIFPSTSEVYGMCSDKYFDEDHSNIVGPVNKPRWIY
1edzA           SDVVITGVPSENYKFPTEYIKEGAVCINFACTKNFSDDVKEKA-------SLYVPMTGKV----------
2bfoA           DVLVNNASSFYPTPLLRGDREAMETATADNAIAPYFLIKAFAHAKHRGTNYSIINMDAMTNQPLLGYTIY
2e6gA           FPAYRVRGTPADCVALGLHL---FGPVDLVLSGVN---------LGSNLGHEIWHSGTVAAKQGYLFGLS
3c3xA           DVVISALAVPQYLDQFKILEAIKVAGNIKR------------------FLPSDFGVEEDRINALPPFEAL
1buaB           -----------------------NALYDEDVCGIISAGKIYPLGSDTKVLSTIFELFSRIINKIAEKHGY
3bmkC           AFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSRQKNLSIVNLCDAMVDPCMAFSLY
1di7A           HLVLTTGGT--GPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTQVGVIRKQALILNLGQPKSIKE
1dj3A           FAERLEPFIADTVHVLNESIRQKKKILVEGGQATMLDIDFGTYPFVTSSSPSAGGICTLGIAPRVIGDLI
2bfaD           DVLVNNASSFYPTPLLRDRETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSITNQPLLGYTIY
1bw3A           DLDWDTVFTKID----TNGIGYQQGHLNVNYQF-------------------------------------
2bfpB           PAPVNNASSFYPTPLLGDREAMETATADLFGSNAIAPYFLIKAFAHRTNYSIINMVDAMTNQPLLGYTIY
3cxtA           VGIIDILVNNAGIIRIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGKIINISMMSELGRETVSAY
3ctmA           DVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKG-SLIITSSISGKIVQLQAP
3e9nD           DKLKNLDHVDTLVHAASVAEWHAHLDLNVIV---PAELSRQLLPALRAASGCVIYINNTIYAASKHAL--
3e5mA           FIVTNAWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVE--------
1adeA           VSDLLDQARQRGDFVM----------FEGAQGTLLDIDHGTYPYVTSS-NTTAGGVATGSLGPRYVDYVL
2cukA           GAILLNTARGALVDTEALV-----EALRGHLFGAGLDVTDPEPLPPGHPLYALPNAVITPHI----GSAG
2bfaB           NNASSFYPTPLLRGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTNYSIINMVDAMTNQPLLGYTIY
2a35A           QLDGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRA----LEMGARHYLVVSALGADA-KSSIFY
3e9qB           YPRLDGVLHNAGLLGDVCPSEQNPQVWQDINVNATFLTQALLPLLLKSDAGSLVFTSSSVGQGRANWGAY
2e6eD           DCVALGLHLFGPVDLVLSGVNLVAAAKQGYLFGLSAAAFSVPEVPDERPFLVNVNLPLRP-------KGF
1cg4A           VSDLLDQARQRGDF-----------VMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYL
3d7lF           DAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDK--GSFTLTTGIEDP----IVQG
1e7wA           DVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNDAMTNQPLLGYTIY
3e9nH           NLDHVDTLVHAASVAEWHAHLDLNVIVPAELSRQLLPALRAASG-------CVIYINGNTIYAAS-----
3bmeB           DVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQ---RQNLSIVNLCDAMVDQPCMAFSLY
3d5tC           CAFPLLAGVVITDDPKDLLSANAEIFTVQGAALNEVASRDVKVLVVGNPANTNAYIAMKSAPDLPKKNFT
3d3jA           DLVINCLDCPENVFLRDQP--WYKAAVAWANQNRAPVLSIDPPVHIDAKWSLALGLPLPLEHAGRIYLCD
3e9nF           DKLKNLDHVDTLVHAASVAEWHAHLDLNVIVPAELSRQLLPALRAASGCVIYINGNTIYAAS--------
1e92C           CDVLVNNASSFYRNDREAMETATADLFGSNAIAPYFLIAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIY
2c5aA           MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAF
2e6eB           FPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLAAAKQGYLFG----LSAAAFSVPLEVP--------DF
3dtdB           FGILVSKPVRLQVDGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAGK-HLKLAMTIAAPG----EPPL
2bf7B           CDVLVNNASSFYPTPLLREAMETADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTVDAMTNQPLLGYTIY
3dfzB           DQLVNMASSFSDGNIQQFSRGRLSLAISTDGASPLLTKRIKLSSNYDESYTQYTQFLYEC--RVLIHRLN
2eggA           -----------------------LRPGVIVSDIIYNPLETKWLKEAKARGARVQNGVGMLVYGALAFEKW
1e6uA           VGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMASELLQGTLEPTNEPY
1a7aB           AIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAGHQVAQIELWTHP
3dooA           -------------------------SHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVHQAESFKIW
2e6gJ           RAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNL--GSNLGHEIWHSGTVAAAQGYLFGLS
1a4iA           AYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRF--------------------------------
1a4iB           KPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPG----GVGPMTVAMLMQST-----V
1e92B           ---------------------------------------------------------------------Y
2bfaC           PAPVASSFYPTPLLRREAMETATADLFGSNAIAPYFLIKAFAHRVRGTNYSIINMVDAMTNQPLLGYTIY
3donA           -----------------------LASHTLVSDIVYNPYKTPILIEAEQRGNPIYNGLDMFVHQGAESFKW
2eezA           LKLVTRDMLS--------LMKEGAVIVDVAVDGVVHYGVANMPGAVPRTSTFALTNQTLPLEDAALLKGL
2bfmC           LVNNASSFYPTPLLRREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSITNQPLLGYTIY
2bf7C           DVLVNNASSFYPTPLLEAMETATADLFGSNAIAPYFLIKAFAHRVRGTNYSIINMVDAMTNQPLLGYTIY
3bywC           IGIYTELES-------------------------------------------------------------
2a35B           ELLPQLDGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADA-KSSIFY
2bkaA           DVGFCCLGT-----------TRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNL-LSSKGADKSSNFLY
3e8xA           -----------SHAFASIDAVVFAAGSGPHTGADKTILIDLWGAIKTIQEAEKRGIKRFIVSSVGTVDPD
3bywB           RDVRPIIGI-------------------------------------------------------------
1b0aA           VGDVVFEDAAKRA--SYITPVPGGVGPMTVATLIENTLQACVEYHDP-----------------------
2e6gG           FPAYRVRGTPADCVALGLH---LFGPVDLVLSGV----------NLGSNLGHEIWHSGTV--AAAKQGYL
3dqpA           HFDVDWTPEEAKQLHGDAIINVSGSGGKSLLKVDLYGAVKLQAAEKAEVKRFILLSTIFSLQEKWIGAGF
1civA           WALLIGAKPRGPGMERADLLDINGQIFAEQGKALNAVASPNVKVMVVGNPCNTNAICLKNAPNIPPKNFH
3bywF           RDVRPIIGI-------------------------------------------------------------
1d0iA           GIVINPAAYSHTSVLDALNTCDGLPVVEVHISNIHQREPFR---------HHSYVSQRDGVVAGCGVQGY
3e48B           DT--------------------------------------------------------------------
1ek6B           ----------------------------------------------------------------------
2dt8A           LSLHISGKLSQSAELAAQEFPGRVTVVDTQAASLGVGVLRAKELLEE-----------------------
2ef0A           GFQVNGELLKLLRPGEETTEEAVHGPRSRVFDQALHTAKAVLLTL-------------------------
3eheA           ----------------------------------------------------------------------
2e6gB           FPAYRVRGTPADCVALGLHLFG---PVDLVLSGVN---------LGSNLGHEIWHSGTAAAKQGYLFGLS
1e7rA           VANNTY----------------------------------------------------------------
1a7aA           --VCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAE--GRLVNLGCAGHPSFVSNSFT
1buaA           NDKYNNISYRNW----------------------------------------------------------
2c29D           ----------------------------------------------------------------------
2b69A           ----------------------------------------------------------------------
3bywD           ERDVRPIGI-------------------------------------------------------------
1db3A           SHVAVS--FESPEYTADVDAMGTLRLLEAIRFLGLEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPY
1ddtA           ----------------------------------------------------------------------
3d5tA           CAFPLLAGVVITDDPKVA----------------------------------------------------
1arzB           ----------------------------------------------------------------------
3bywH           ERDVRPIGI-------------------------------------------------------------
2e6gF           APHFPAYRVRGT--PADCVALGLHLFG----PVDLVLSGVNLG----SNLGHEIWHSGTV--AAAKQGYL
1a2zA           EIVINLGLAPTYSNITVERIAVNIIDARIPDNDGYQPIDEK-----------------------------
3dtdA           -GILVSKPVRLQDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAALRAG-KHLKLAMTI------------


                         +         .         .         .         .         *         .:210
query           AAAKSALIGVTRTWALELAPLGITANAVAPGPVETELFRLTHPVGSDEEKRILATIPMQRLGKPEEVASL
1a9zA           GKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGED-PQGIPNNLMPYIAQVAVGRRDSLAIF
1a27A           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
2belC           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMAVSGMQAAPKEECALEIIKGGALRQEEVYYD
1dj2A           GVVKAYTTRVGSGPFPTENLGLLRLAGQEFGTTTGRPRRALKFSCQINGFASLNLTKLDVLSDLNEIQLG
2ae1A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQDPE-----QKENLNKLIDRCALRRMGEPKELAAM
2d1yA           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIA-----RRDWEDLHALRRLGKPEEVAEA
1dohB           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNEYAAVQWSPLRRVGLPIDIARV
2d1yB           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAI----RTRRDWEDLHALRRLGKPEEVAEA
3ce6B           DEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAE-------------YLGVDVEGPYKPDHYR--
3deyX           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTEVLDRTDIHTFHRFYQYLAQVFREAAQNPEEVAEV
2a4kA           AAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPP---WAWEQEVGASPLGRAGRPEEVAQA
3ch6E           SASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQIIKGGALRQEEVYYDSSRW
2cfcA           TTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQ-WRLDQPELRDQVLARIPQKEIGTAAQVADA
3d3eA           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAAVSGIVQAAPKEECALEIIKGGALRQYDSSLW
1bmdA           AMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMF------PDLFHAEVDGRPALELVDMEWYEKV
2cnbB           SPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGADIGEHYQGSTHLIPIILGRVMSDIADKRMPIFGT
2ehdA           NASKFGLLGLAGAAMLDLREANVRVVNVLPGLKPEDVAQAVLFALEMPGHAMVSEIELR-----------
2d1yC           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLEAIALSPDPRRDWEDLHALRRLGKPEEVAEA
1c3vA           GTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHLFGTEGETLTIRHDSLDRTSFVPGVLLA
2d1yD           NASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATE----AVLEAIATRRDWEDLHALRRLGKPEEVAEA
3czrA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVHMQAAPKEECALEIIKGGALRQEEVSLW
3d5qC           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVQ-AAPKEECALEIIKGGALRQEEDSSLW
3ce6A           DEYDNEVYRLPKHLDEKV----ARIHVEALGGHLTK---LTKEQAEYLG------VDVEGPYKPDHYR--
3bmoB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM----GEEEKDKWRRKVPLGRREASAEQIADA
1dfiA           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLMLAHCEA-----------VTPIRRTVTIEDVGNS
3dwfC           SASKFALDGFFSTLRSEFLVVNVSITLCILGLIDTETIKATSPASPKEELEIIKGTALRQDEMYYVGSRW
3d5qD           SASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDTETAMKAVSMQAAPKEECALEIIKGGALRQEEVYYD
3bzuB           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
3ch6B           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSRW
3ctmF           YNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASK---DMKAKWWQLTPLGREGLTQELVGG
2aw5B           YPGQGNNSYVFPGVALGVV--ACGLRQITDNIFLTTAEVIAQQVSDKHEEGRLYPPLNTIRDVSLKIAEK
2ag5A           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPRNDFLKRQKTGRFATAEEIAML
2belA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAGIVHMQAAPKEECALEIIKGGALRQEEVYYDS
3dwfA           SASKFALDGFFSTLRSEFLVVNVSITLCILGLIDTETAIYLGPASPKEELEIIKGTALRQDEMYYVGSRW
2aw5C           ACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNK
2belD           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
3d3wA           CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
2ehdB           NASKFGLLGLAGAAMLDLREANVRVVNVLPGSVKLKPE--------DVAQAVLFALEMPGHAMVSEIE--
2eghA           LPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGR
3ctmH           YNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASK---DMKAKWWQLTPLGREGLTQELVGG
3ce6D           DEYDNEVYRLPK----HLDEKVARIHVEALGGHLTKLT---------KEQAEYLGVDVEPY-KPDHYR--
3e03C           GYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATDAINLP-------------GVDAAACRRPEIADA
2dfdA           GVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTI--IPLISQCTPKVDFPQDQLTALTGRIQEAGT
2dknA           AGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAVETPLLQASKADPRYGESTRRFVAPLGRGSEPREVAEA
2ag5C           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPENDFLKRQKTGRFATAEEIAML
2e37D           QSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEAALSPEDRARIDEGVRRAAYRIIEGKGATYYGIGAG
1bdmA           AMTRLDHNRAKAQLAKK---TGTGVDRIRRMTVWGNHSSIMFP---DLFHAEVDGRPALELVDMEWYEKV
2b35A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGAQIQLL-----EEGWDQRAPIGWNMKDATPVAKT
2b4qB           GPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIAN-DPQALEADSASIPMGRWGRPEEMAAL
2ag5B           STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDRQKTGRFATAEEIAML
3e03B           GYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATDA-------------INLPGVDAAACRRPEIADA
1dhrA           GMAKGAVHQLCQSLAGKGMPSGAAAIAVLPVTLDTPMNRKSMP-----------EADFSSWTPLEFLVET
3bhmA           LQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKITKSPEEGAETPVYLALLPPDAEGP
3c6cA           GVLWGAPASTETIYQRNLIPANAQWAAFGIGRDQPAQAALLGGNVRVGLEDNLYLSRGVFATNGQLVERA
2b35E           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTAGAQIQLLEEGWDQRAP----IGWNMKDATPVAKT
3d7lA           ASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDK---------------LEPFFEGFLPVPAAKV
3e48A           LPELNHKLIYPAGDGRINYITRNDIARGVIAIIKNPDLSGYSYD-KELAAILSEASGTEIKYEPVSLETF
1bhsA           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFME--KVLGSPEEVAHSKQVFREAAQNPEEVAEV
1b8pA           AMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSP----------------------------------
3edmB           ATSKGAVMTFTRGLAKEVGP-KIRVNAVCP-----------------------GMISTTREGSSEDVAGL
2ekpA           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTL-PLRQNPELYEPITARIPMGRWARPEEIARV
3e9qA           GAYAASKFATEGQVLADEYQQRLRVNCINPGGTRTARASAFPT------------EDPQKLKTPADIPLY
2e6gK           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
2cnbC           SPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHEDGDIG---------------------------
1edoA           AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTAKLGE---DMEKKILGTIPLGRTGQPENVAGL
3bzuD           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
1a9yA           GKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGED-PQGIPNNLMPYIAQVAVGRRDSLAIF
2a92C           LGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGN---KMVLLKRYITVGGIPLQEFINNKKITDEEVEG
3csdB           SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHTEEAFDRITARVPIGRYVQPSEVAEM
2e37E           QSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAESPEDRARID-----------EGVRRAAYRIIEGKGA
2cnbA           GESKLIAERMIRDCAEA---YGIKGICLRYFNAC---GAHEDGDIGEHYQGSTHLIPIILGRVMSDIAPD
2ekqD           TTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETELYEPITA-----------RIPMGRWARPEEIARV
1bxkB           TETTASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILPVYGNGQQIRDWLYVEDHARA
3ek2B           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKFGKIL----------DFVESNSPLKRNVTIEQVGNA
3bmeC           NMGKHALVGLTQSAALELAPYGIRVNGV------------APGVSLLPDKWRRKVPLGRREASAEQIADA
3c2qA           SYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG-------------------------------------
3edmA           ATSKGAVMTFTRGLAKEVGP-KIRVNAVCPGMIST------------------------REGSSEDVAGL
3dwfB           SASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTETAIKATSPKEECALEIIKGTALRQDEMYYVGSRW
3dijA           ASAKGGIVALTH-ALAMSLGPDVLVNCIAPGWINVTFTQEDCA-----------AIPAGKVGTPKDISNM
2dknB           AGSKYAVTCLARRNVVDWAGRGVRLNVVAP-----------------------GVAPLGRGSEPREVAEA
3ek2A           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIS------GIKSFGKILDFVESNSPLKRNVTIEQVGNA
2c29F           AWMYFVSKTLAEQAWKYAKENNIDFITIIPT---------------------------------------
1c9kB           NRLARHFRDIAGRVNQRLAAAADEVWLVVSGIGVK-----------------------------------
3d5qB           SASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGECALEIIKGGALRQEEVYYDSSLW
2belB           SASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
3dxfB           QKAPDGKSYLLSLPTGDVPMDGMSVSDLGPVVLSLLKM--------PEKYVGQNIGLSTCRHTAEEYAAL
1e7qA           AIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGPHDN-FHPSNSHVIPALLRRFHEATAQSAPDV---
3ch6A           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSRW
3d4nD           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTMKAVSGIHMQAAPKEECALEIIKGGALRQEEVYYW
3c2qB           SYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG-------------------------------------
3diiA           ASAKGGIVALTHALAMSLGP-DVLVNCIAPGWINVTEFT----------QEDCAAIPAGKVGTPKDISNM
1bxkA           TETT------------------------------------------------------------------
2e37C           VLGEHGDSEVLVWSSAQVGGVPLLEFAEARGRALSP---EDRARIDEGVRRAAYRIIEGKGATYYGIGAG
2a4kB           LTGKLGVVGLARTLALELARKGVRVNVLLPGLIQA-------------WEQEVGASPLGRAGRPEEVAQA
2e37B           APQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARGRALS---PEDRARIDEGVRRAAYRIIEGKGA
3ch6D           SASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSRW
1c9yA           PEAENRKWTIMAVMVSLLTDYSPQLQKP------------------------------------------
3d7lD           ASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDK---------------LEPFFEGFLPVPAAKV
1bsvA           AIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGPHDN-FHPSNSHVIPALLRRFHEATAQNAPDV---
2c5eB           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPFGT---WKGGREAAPAAFCRKAQTSTDRFEMW--
3d64A           FTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSD-DQAAYIGVSKAGPFKPDHYR----------
3d3uA           LRGAKRSKGGISIMAFPSTAKKGTESRIVPILKTGRNEVDYVVTE--------YGVARLRGATLRQRAEA
2bd0A           CMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGKVDD------------EMQALMMMPEDIAAP
3ek2D           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKSFGKI---------LDFVESNSPLKRNVTIEQVGNA
1ahhA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDAL--KSVITPEIEQKMLQHTPIRRLGQPQDIANA
3d4nC           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIMQAAPKCALEIIKGGALRQEEVSLW
3d4nB           SASKFALDGFFSSIRKEYSVVNVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
3e03A           GYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIA-------------------TGVDAAACRRPEIADA
2e6hD           AAAFSVPLGEVPDFAG-LRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPDPMGRPFYWFAPRPLKEAEEGT
2e6cC           LAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
3d7lB           AAANGAVTAFA--KSAAIEPRGIRINTVSPNVLEESWDKLEP---------------FFEGFLPVPAAKV
3bmfB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPGRREASAEQIADA
1bdmB           AMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSIMF------PDLFHAEVDGRPALELVDMEWYEKV
3byzA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
3ctmG           NTAKAA-CTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASK---DMKAKWWQLTPLGREGLTQELVGG
2c5aB           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYG---PFGTWKGGREKAPAAFCRKAQTSTDRFEM---
2bgkA           TATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTFGVDSSRVEELAHQAANLKGTLLRAEDVADA
1dohA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHENLSNEEVDEYAAVQWSPLRRVGLPIDIARV
2b36B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTALGEEAGAQIQLLEEGWDQRAPIGNMKDATPVAKT
1d7oA           SSAKAALESDTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQKTLTADEVGNA
1c9kA           RHFRDIAGRVNQ----RLAAAADEVWLVVSGIGVK-----------------------------------
3bzuC           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAM-KAVMQAAPKEECALEIIKGGALRQEEVYYD
2dteA           VTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRSDPMRIEKKISEWGHEHPMQRIGKPQEVASA
3bzuA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQLEIIKGGALRQEEVYYDSSLW
1e7sA           AIARIAGIKLCESYN---RQYGRDYRSVMPTNLYGPHDNFHPS-NSHVIPALLRRFHEATAQSAPDV---
3ek2C           GLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKTSFGKILD--------FVESNSPLKRNVTIEQVGNA
3dfzA           SRKHELLTEIIDDQRLSLVKQREFLQQIEK----------------------------------------
1di6A           GQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLE---------------------------------
2c07A           SSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQIKK--------NIISNIPAGRMGTPEEVANL
2e6hB           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
2c54A           GLERLATEELCKHYNKDFGIECRIGRFHNIYG--------------------------------------
1cydA           SSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGK-KVSADPEFARKLKERHPLRKFAEVEDVVNS
3edmC           ATSKGAVMTFTRGLAKEVGPKIRVNAVCPGSSEDV-----------------------------------
1e6wD           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLT--TLPDKVRNFLASQVPFPSRLGDPAEYAHL
1e3sA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPSQV----------------PFPSRLGDPAEYAHL
3d3eB           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAAVSGIVQAAPKEECALEIIKGGALRQEESSLW
3bmnD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPGRREASAEQIADA
2aqkA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGIQLLEEGWDQRAPIGWNMKDATPVAKT
2c7vD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPGRREASAEQIADA
3cxrA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTA-PLRELHPFDQFIIAKTPAARWGEAEDLMGP
1ae1A           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQKEEIDNFI----------VKTPMGRAGKPQEVSAL
1cbuC           NRLARHFRDIAGRVNQRLAAAADEVWLVVSG---------------------------------------
2c82A           TASGGPFRGWSAADLEHVTPEQAGAH--PTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVVVH
2aqhA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMEAGAQIQLLEEGWDQRAPIGWNMKDATPVAKT
3d4nA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVHMQAAPKEECALEIIKGGALRQEEVYLW
3cq0B           AETDPGVLSVKKIYS-YYKRHGYATEVMAASFRNLDELKNMTLPLNLLEQLYESTDPIENKLNSESEGVE
3bmqA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEE----EKDKWRRKVPLGRREASAEQIADA
1e6wB           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTFLAS----------QVPFPSRLGDPAEYAHL
2b35C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLLEE----------GWDQRAPIGWNMKDATPVAKT
2c54B           GLERLATEELCKHYNKD---FGIECRIGRFHNIYGP---FGTWKGGREKAPAAFCRKAQTSTDRFEM---
2e37A           AYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARALSPEDRARID-----------EGVRRAAYRIIEGKGA
1ek5A           GKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGC-IGEDPQGIPNNLMPYVSQVAIGRREALNVF
3edmD           ATSKGAVMTFTRGLAKEVGPKIR--------------------------------VNAVCPGSSEDVAGL
1e6wC           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLT---------NFLASQVPFPSRLGDPAEYAHL
2aqiA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEGWDQRAPIGWNMKDATPVAKT
2axqA           KTIDEVHRAGGKLKSFLSYCGGLPAPEDSDNPLGYKFSWSSR----GVLLALRNSAKYWKDGKIETVSSE
2b4qA           GPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHIAN-DPQALEADSASIPMGRWGRPEEMAAL
2ae2A           GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEIQDPEQKENLNKLIDRCALRRMGEPKELAAM
3d5qA           SASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAM-KAVMQAAPKEECALEIIKGGALRQEEVYYD
1e3wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPG------LFATPLLTTVRNFLASQVPFPSRLGDPAEYAHL
3e9nC           -------RGLADAFRKEEANNGIRVSTVSPGPEPKEIANAIRFVIDAGETTQITNVDVR-----------
2aq8A           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAGAQIQLLEEGWDQRAPIGWNMKDATPVAKT
2e6cD           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
2c7vA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
3bmiB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRK----VPLGRREASAEQIADA
2c7vB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
2a92B           LGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLLKRY---ITVGGIPLQEFINNKKITDEEVEG
3e6vA           GTPYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTP---EEVTRTV----NTAVAITLACFGLAREGNHK
3bmnB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
2b37C           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGALGAGAQIQLLEEGWDQRAPIGWNMKDATPVAKT
1d4gA           WTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTE----KQAQYLG-----MPINGPFKPDHYR--
3bmfC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLGEEEKDKW---------RRKVPLGRREASAEQIADA
1a4uA           SASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNS--WLDVEPRVAELLLSHPTQTSEQCGQ
1bdbA           TAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDLRGPSSL--GPLADMLKSVLPIGRMPEVEEYTGA
1c14A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKD-FRKMLAHCEAVTPIRRTVTIEDVGNS
2c59B           GLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREK---------------------------
2c59A           GLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKG-------------------------------
3ctmB           NTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDI----TDFASKDMKAKWWQLTPLGREGLTQELVGG
2e6bD           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
3e9nB           AASKHALRGLADAFRKEEANNGIRVSTVSPIEPKEIANAIRFVIDAGETTQITNVDVRPRI---------
2aw5A           PNGQTLYPGQGNNSYVFPGV-ALGVVACGLRQITDNIFLAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLK
1b3rA           TNQVDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTK---LTEKQAQYLG------MPINGPFKPDHYR--
2bfaA           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW-----EGHRSKVPLYQRDSAAEVSDV
3ctmE           NTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDM----KAKWWQLTPLGREGLTQELVGG
3ctmC           AKAA---CTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDMKAKWWQL---TPLGREGLTQELVGG
1cg1A           GILKAYSTRVGAPFPTELFD--------------------------------------------------
1e7wB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDW----------EGHRSKVPLYQRDSSAAEVSDV
1bwsA           AIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGPHDNFHPS---------------------------
2bf7A           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW-----EGHRSKVPLYQRDSAAEVSDV
1cwuA           SSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAKAIGFID-TMIEYSYNNAPIQKTLTADEVGNA
3bmdB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEK-----DKWRRKVPLGRREASAEQIADA
3bmqC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
2c7vC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRREAAEQIADA
1ae1B           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQKEEIIVKTPMGRAGKPQEVSAL
2c5eA           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPFGT---WKGGREAAPAAFCRKAQTSTDRFEM---
3ctmD           NTAKAACTHLAKSLA-IEWAPFARVNTISPGYIDTDITDFASK---DMKAKWWQLTPLGREGLTQELVGG
3dhnA           PGVKAL----GEFYLNFLKEKEIDWVFFSPAADRPGVRTGRYRLG----KDDIVDIVGNSHISVEDYAAA
3bmeA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
2b35B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEEGWDQRA------------PIGWNMKDATPVAKT
2b37B           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEGWDQRAP-------------IGWNMKDATPVAKT
2b35F           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTQIQLLEEG-------WDQRAPIGWNMKDATPVAKT
3bmfD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
3e5mB           FDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHFL---PQKAPDGKSYLLSLPTGDVPMDGMSVSDLGPV
2c20A           GETKLAIEKMLHWYSQAS---NLRYKIFRYFNVAGATPNGIIGEDHRPETHLIPLVLQVALGQREKI---
2b35D           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMEGWDQR----------APIGWNMKDATPVAKT
3bmoA           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRK----VPLGRREASAEQIADA
2bfmB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW-----EGHRSKVPLYQRDSAAEVSDV
3bmfA           YNMGKHAVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEK-----DKWRRKVPLGRREASAEQIADA
1e92A           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSK----VPLYQRDSSAAEVSDV
2e6bC           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
3bmoD           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
1d4fA           LWTPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTK---LTEKQAQYLG------MPINGPFKPDHYR--
3bmoC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRK----VPLGRREASAEQIADA
2bfoC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDGHRSK------------VPLYQRDSSAAEVSDV
3bmnC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRK----VPLGRREASAEQIADA
3e9nE           -------RGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDVR-----------
3e9nA           -------RGLADAFRKEEANNGIRVSTVSPGPTRPEIY-----------------------IEPKEIANA
2a92A           LGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVLL------------------------------
2e6hC           AAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
3dxfA           FDGKGEVEEYFRDIGVPMTSVRL---PCYFENLLSHFLPQKAPDGKSYLLSLPTGDVPMDGMSVSDLGPV
1cg3A           GILKAYSTRVGAGPFPTELETGEFLCKQGNE---------------------------------------
1e6wA           SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFAT------PLLTKVRNFLASQVPFPSRLGDPAEYAHL
2bllA           SVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARI---GSSRAITQLILNLVEGSPIKL---
1edzA           ----------------------------------------------------------------------
2bfoA           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW-----EGHRSKVPLYQRDSAAEVSDV
2e6gA           AAAFSVPGEVPDFAGLRPFLVNVNLPLRPKGFLWTRQSVRAY-----EGVVIPGEDPMGRAPRPLKEAEE
3c3xA           IERKRMIRRAIEEANIPYTYVSA--NCFASYFINYLLRPYDPK---DEITVYGTGEAKFAMNYEQDIGLY
1buaB           IVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKKFTLGGYTSFIRNNNIVYPFDQYILKTYNINEL
3bmkC           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
1di7A           TLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVETAPEV---------VAAFRPKSARR-----------
1dj3A           GVVKAYTTRVGSGPFPTELDVLRKAGMEFGTTTGRPRRCALKYCCDINGFSSLNLTKLDVLSGLPEIKLG
2bfaD           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVHRS--------------KVPLYQRDSSAAEVSDV
1bw3A           ----------------------------------------------------------------------
2bfpB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW-----EGHRSKVPLYQRDSAAEVSDV
3cxtA           AAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTH-------PFDQFIIAKTPAARWGEAEDLMGP
3ctmA           YNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASK---DMKAKWWQLTPLGREGLTQELVGG
3e9nD           -------RGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDVR-----------
3e5mA           --------EYFRDIGVPMTSVRLPCYFENLLSHFLPQKAPDGK---SYLLSLPTGDVPMDGMSVSDLGPV
1adeA           GILKAYSTRVGA------------------GPFPTEL--------FDETGEFLCKQ--------------
2cukA           RTTRERMAEVAVENLLAVLEGREPPNPV------------------------------------------
2bfaB           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW-----EGHRSKVPLYQRDSAAEVSDV
2a35A           NRVKGELEQALQEQ------GWPQLTIARPSLLFGPR----------EEFRLAEILAAPIAGKYHGEGKG
3e9qB           AASK---FATEGQVLADEYQQRLRVNCINPGGTRTARASAFPT------------EDPQKLKTPADIPLY
2e6eD           LWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLK------EAEEGTDRWQGFVSATPLR-----------
1cg4A           GILKAYSTRVPTELFDETGE-FLCKQGNEFGATTGLRRRAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLC
3d7lF           ASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDKLEP---------------FFEGFLPVPAAKV
1e7wA           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW----EGHRSKVPLYQRDSSAAEVSDV
3e9nH           ---KHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDVR-----------
3bmeB           NMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAM-----GEEEKDKWRRKVPLGRRASAEQIADA
3d5tC           AMLRLDHNRALSQLAAK---SGKPVASIEKLAVWGNHSPTMYP---DFRFATAEGESLLKLINDD-----
3d3jA           IGIPQVGINYHSPFGCKFVI--------------------------------------------------
3e9nF           ---KHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIANAIRFVIDAGETTQITNVDV------------
1e92C           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVP-------------LYQRDSSAAEVSDV
2c5aA           GLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPFGT-------------------------------
2e6eB           AGLRPWLLRTLETLLRLERPVNVNLPLRPKGFLWTRQSV-RAYEGVVIPGEDPMGRPFYWFAKEAEEGTD
3dtdB           NDLFVQLNGFSNALNRLIALQK------------------------------------------------
2bf7B           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSK----VPLYQRDSSAAEVSDV
3dfzB           VSKSRKHELLTEIIDDQYR---------------------------------------------------
2eggA           TGQWPDVNRMKQLVIEALR---------------------------------------------------
1e6uA           AIAKIAGIKLCESYN---RQYGRDYRSVMPTNLYGPHDN-FHPSNSHVIPALLRRFHEATAQKAPDV---
1a7aB           DKYPVGVHFLPKKLDEA----VAEAHLGKLNVKLTKLTE-------------------------------
3dooA           TNLEPDIKAMKNIVIQKLK---------------------------------------------------
2e6gJ           AAAFSVPLN-GEVPDFGLRPVNVNLPLRPKGFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEE
1a4iA           ----------------------------------------------------------------------
1a4iB           ESAKRFL---------------------------------------------------------------
1e92B           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVW-----EGHRSKVPLYQRDSAAEVSDV
2bfaC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVRSK---------------VPLYQRDSSAAEVSDV
3donA           TNLEPDIKAMKNIVIQKLKGELL-----------------------------------------------
2eezA           NTHKGRL--THPGVAEAFGLPYTPPEEALRG---------------------------------------
2bfmC           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVP-------------LYQRDSSAAEVSDV
2bf7C           TMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVP-------------LYQRDSSAAEVSDV
3bywC           ----------------------------------------------------------------------
2a35B           NRVKGELEQALQEQG------WPQLTIARPSLLFGP----------------------------------
2bkaA           LQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVR----KFFGSLPDSWASGHSVPVVTVVRA
3e8xA           QGPNRHYLVAKRLADDELKRSSLDYTIVRPGPLSNEESTGKVT-------VSPHFSEITRSITRHDVAKV
3bywB           ----------------------------------------------------------------------
1b0aA           ----------------------------------------------------------------------
2e6gG           FGLSAAAFSVPLGEVPDFAGVNVNLPLRPKGFLWTRQ---------------------------------
3dqpA           DALKDYYIAKHFADLYLTKETNLDYTIIQPGALTEEEATGLIDIN----------DEVSASNTIGDVADT
1civA           ALTRLDENRAKCQLALK---AGVFYDKVSNVTIWG---NHSTTQVPDFLNAKIHGIPVTEVIRD------
3bywF           ----------------------------------------------------------------------
1d0iA           VFGVERIAA-------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
1ek6B           ----------------------------------------------------------------------
2dt8A           ----------------------------------------------------------------------
2ef0A           ----------------------------------------------------------------------
3eheA           ----------------------------------------------------------------------
2e6gB           AAAFSVPLNGERPWLLRTLEVNVNLPLRPKGFLWTRQSV-RAYEGVVIPGEDPMGRPFYWFA--------
1e7rA           ----------------------------------------------------------------------
1a7aA           NKYPVGVHFLPKKLDEAV----AEAHLGKLNVKLTKLTE-------------------------------
1buaA           ----------------------------------------------------------------------
2c29D           ----------------------------------------------------------------------
2b69A           ----------------------------------------------------------------------
3bywD           ----------------------------------------------------------------------
1db3A           AVAKLYAYWITVNYR-------------------------------------------------------
1ddtA           -----------DSETADNLEKTTAALSILPGIGSVMGIA-DGAVHHNTEEIVAQSIALSSLMVAQAIPLV
3d5tA           ----------------------------------------------------------------------
1arzB           ----------------------------------------------------------------------
3bywH           ----------------------------------------------------------------------
2e6gF           FGLSAAAFSPLNGEVPDFA---------------------------------------------------
1a2zA           ----------------------------------------------------------------------
3dtdA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ISYLISDGASFVTxxxxxxxxxxxxxxx
1a9zA           GNDYPTEDGTG-----------------
1a27A           FLTALRAPLRYFT---------------
2belC           SSLWTTLLIR------------------
1dj2A           VAYKRSDGTPVKS---------------
2ae1A           VAFLCFPAASYVT---------------
2d1yA           VLFLASEKASFIT---------------
1dohB           VCFLASNDGGWVT---------------
2d1yB           VLFLASEKASFIT---------------
3ce6B           ----------------------------
3deyX           FLTAL-----------------------
2a4kA           ALFLLSEESAYIT---------------
3ch6E           TTLLIRNPCRKIL---------------
2cfcA           VMFLAGEDATYVN---------------
3d3eA           TTLLIRNPSRKIL---------------
1bmdA           FIPTVA----------------------
2cnbB           DYP-------------------------
2ehdA           ----------------------------
2d1yC           VLFLASEKASFIT---------------
1c3vA           VRRIAERPGLTVG---------------
2d1yD           VLFLASEKASFIT---------------
3czrA           TTLLIRNPSRKIL---------------
3d5qC           TTLLIRNPSRKIL---------------
3ce6A           ----------------------------
3bmoB           VIFLVSGSAQYIT---------------
1dfiA           AAFLCSDLSAGIS---------------
3dwfC           VPYLLGNPG-------------------
3d5qD           SSLWTTLLIRNPS---------------
3bzuB           TTLLIRNPSRKIL---------------
3ch6B           TTLLIRNPCRKIL---------------
3ctmF           YLYLASNASTFTT---------------
2aw5B           IVKDAYQEKTATV---------------
2ag5A           CVYLASDESAYVT---------------
2belA           SLWT------------------------
3dwfA           VPYLLGNPG-------------------
2aw5C           EAFVRSQMYSTDY---------------
2belD           TTLLIRNPCRKI----------------
3d3wA           ILFLLSDRSGMTT---------------
2ehdB           ----------------------------
2eghA           KISVDSATMMNKG---------------
3ctmH           YLYLASNASTFTT---------------
3ce6D           ----------------------------
3e03C           AHAVLTREAAGFH---------------
2dfdA           EVVKAKAGAGSAT---------------
2dknA           IAFLLGPQASFIH---------------
2ag5C           CVYLASDESAYVT---------------
2e37D           LARLVRAILTDEK---------------
1bdmA           FIPTVAQGAAII----------------
2b35A           VCALLSDWLPATT---------------
2b4qB           AISLAGTAGAYMT---------------
2ag5B           CVYLASDESAYVT---------------
3e03B           AHAVLTREAAGFH---------------
1dhrA           FHDWITGNKRPNS---------------
3bhmA           HGQFVSEKR-------------------
3c6cA           R-TVIEHLGSVAT---------------
2b35E           VCALLSDWLPATT---------------
3d7lA           ARAFEKSVFGAQT---------------
3e48A           A---------------------------
1bhsA           FLTALRA---------------------
1b8pA           ----------------------------
3edmB           VAFLASDDAAYVT---------------
2ekpA           AAVLCGDEAEYLT---------------
3e9qA           --LWLGDDSRRKT---------------
2e6gK           GTDRWAVAQGFVS---------------
2cnbC           ----------------------------
1edoA           VEFLASPAASYIT---------------
3bzuD           TTLLIRNPSRKIL---------------
1a9yA           GNDYPTEDGTGVR---------------
2a92C           IFDRTVNTAL------------------
3csdB           VAYLIGPGAAAVT---------------
2e37E           TYYGIGAGLARLV---------------
2cnbA           DKRMPIFGTDY-----------------
2ekqD           AAVLCGDEAEYLT---------------
1bxkB           LYCVATTGKVGET---------------
3ek2B           GAFLLSDLASGVT---------------
3bmeC           VIFLVSGSAQYIT---------------
3c2qA           ----------------------------
3edmA           VAFLASDDAAYVT---------------
3dwfB           VPYLLGNPGRKIM---------------
3dijA           VLFLCQQ--DFIT---------------
2dknB           IAFLLGPQASFIH---------------
3ek2A           GAFLLSDLASGVT---------------
2c29F           ----------------------------
1c9kB           ----------------------------
3d5qB           TTLLIRNPSRKIL---------------
2belB           TTLLIRNPCRKI----------------
3dxfB           LTKHTR----------------------
1e7qA           ----------------------------
3ch6A           TTLLIRNPCRKIL---------------
3d4nD           TTLLIRNPSRKIL---------------
3c2qB           ----------------------------
3diiA           VLFLCQQ--DFIT---------------
1bxkA           ----------------------------
2e37C           LARLVRA---------------------
2a4kB           ALFLLSEESAYIT---------------
2e37B           TYYGIGAGLARLV---------------
3ch6D           TTLLIRNPCRKIL---------------
1c9yA           ----------------------------
3d7lD           ARAFEKSVFGAQT---------------
1bsvA           ----------------------------
2c5eB           ----------------------------
3d64A           ----------------------------
3d3uA           LTAIAHPDFRALE---------------
2bd0A           VVQAYLQPSRTVV---------------
3ek2D           GAFLLSDLASGVT---------------
1ahhA           ALFLCSPAASWVS---------------
3d4nC           TTLLIRNPSRKIL---------------
3d4nB           TTLLIRNPSRKIL---------------
3e03A           AHAVLTREAAGFH---------------
2e6hD           DRWAVAQ--GFVS---------------
2e6cC           GTDRWAVAQGFVS---------------
3d7lB           ARAFEKSVFGAQT---------------
3bmfB           VIFLVSGSAQYIT---------------
1bdmB           FIPTVAQGAAII----------------
3byzA           TTLLIRNPSRKIL---------------
3ctmG           YLYLASNASTFTT---------------
2c5aB           ----------------------------
2bgkA           VAYLAGDESKYVS---------------
1dohA           VCFLASNDGGWVT---------------
2b36B           VCALLSDWLPATT---------------
1d7oA           AAFLVSPLASAIT---------------
1c9kA           ----------------------------
3bzuC           SSLWTTLLIRNPS---------------
2dteA           VAFLASREASFIT---------------
3bzuA           TTLLIRNPSRKIL---------------
1e7sA           ----------------------------
3ek2C           GAFLLSDLASGVT---------------
3dfzA           ----------------------------
1di6A           ----------------------------
2c07A           ACFLSSDKSGYIN---------------
2e6hB           GTDRWAVAQGFVS---------------
2c54A           ----------------------------
1cydA           ILFLLSDRSASTS---------------
3edmC           ----------------------------
1e6wD           VQMVIEN--PFLN---------------
1e3sA           VQMVIEN--PFLN---------------
3d3eB           TTLLIRNPSRKIL---------------
3bmnD           VIFLVSGSAQYIT---------------
2aqkA           VCALLSDWLPATT---------------
2c7vD           VIFLVSGSAQYIT---------------
3cxrA           AVFLASDASNFVN---------------
1ae1A           IAFLCFPAASYIT---------------
1cbuC           ----------------------------
2c82A           PQSIIHSMVTFID---------------
2aqhA           VCALLSDWLPATT---------------
3d4nA           TTLLIRNPSRKIL---------------
3cq0B           KVSFINDEPHFRY---------------
3bmqA           VIFLVSGSAQYIT---------------
1e6wB           VQMVIEN--PFLN---------------
2b35C           VCALLSDWLPATT---------------
2c54B           ----------------------------
2e37A           TYYGIGAGLARLV---------------
1ek5A           GNDYDTEDGTGVR---------------
3edmD           VAFLASDDAAYVT---------------
1e6wC           VQMVIEN--PFLN---------------
2aqiA           VCALLSDWLPATT---------------
2axqA           DLMATAKPYFIYP---------------
2b4qA           AISLAGTAGAYMT---------------
2ae2A           VAFLCFPAASYVT---------------
3d5qA           SSLWTTLLIRNPS---------------
1e3wA           VQMVIEN--PFLN---------------
3e9nC           ----------------------------
2aq8A           VCALLSDWLPATT---------------
2e6cD           GTDRWAVAQGFVS---------------
2c7vA           VIFLVSGSAQYIT---------------
3bmiB           VIFLVSGSAQYIT---------------
2c7vB           VIFLVSGSAQYIT---------------
2a92B           IFDRTVNTALEI----------------
3e6vA           PIDYLN----------------------
3bmnB           VIFLVSGSAQYIT---------------
2b37C           VCALLSDWLPATT---------------
1d4gA           ----------------------------
3bmfC           VIFLVSGSAQYIT---------------
1a4uA           NFVKAIE--ANKN---------------
1bdbA           YVFFATGDAAPAT---------------
1c14A           AAFLCSDLSAGIS---------------
2c59B           ----------------------------
2c59A           ----------------------------
3ctmB           YLYLASNASTFTT---------------
2e6bD           GTDRWAVAQGFVS---------------
3e9nB           ----------------------------
2aw5A           IAEKIVKDAYQEK---------------
1b3rA           ----------------------------
2bfaA           VIFLCSSKAKYIT---------------
3ctmE           YLYLASNASTFTT---------------
3ctmC           YLYLASNASTFTT---------------
1cg1A           ----------------------------
1e7wB           VIFLCSSKAKYIT---------------
1bwsA           ----------------------------
2bf7A           VIFLCSSKAKYIT---------------
1cwuA           AAFLVSPLASAIT---------------
3bmdB           VIFLVSGSAQYIT---------------
3bmqC           VIFLVSGSAQYIT---------------
2c7vC           VIFLVSGSAQYIT---------------
1ae1B           IAFLCFPAASYIT---------------
2c5eA           ----------------------------
3ctmD           YLYLASNASTFTT---------------
3dhnA           IDELEHPKHH------------------
3bmeA           VIFLVSGSAQYIT---------------
2b35B           VCALLSDWLPATT---------------
2b37B           VCALLSDWLPATT---------------
2b35F           VCALLSDWLPATT---------------
3bmfD           VIFLVSGSAQYIT---------------
3e5mB           VLSLLKMPEKY-----------------
2c20A           ----------------------------
2b35D           VCALLSDWLPATT---------------
3bmoA           VIFLVSGSAQYIT---------------
2bfmB           VIFLCSSKAKYIT---------------
3bmfA           VIFLVSGSAQYIT---------------
1e92A           VIFLCSSKAKYIT---------------
2e6bC           GTDRWAVAQGFVS---------------
3bmoD           VIFLVSGSAQYIT---------------
1d4fA           ----------------------------
3bmoC           VIFLVSGSAQYIT---------------
2bfoC           VIFLCSSKAKYIT---------------
3bmnC           VIFLVSGSAQYIT---------------
3e9nE           ----------------------------
3e9nA           IRFVIDAGET------------------
2a92A           ----------------------------
2e6hC           GTDRWAVAQGFVS---------------
3dxfA           VLSLLKMPEKYVG---------------
1cg3A           ----------------------------
1e6wA           VQMVIEN--PFLN---------------
2bllA           ----------------------------
1edzA           ----------------------------
2bfoA           VIFLCSSKAKYIT---------------
2e6gA           GTDRWAVAQGFVS---------------
3c3xA           TIKVATDPRAL-----------------
1buaB           NEIPKPY---------------------
3bmkC           VIFLVSGSAQYIT---------------
1di7A           ----------------------------
1dj3A           VSYNQGEKLQSFP---------------
2bfaD           VIFLCSSKAKYIT---------------
1bw3A           ----------------------------
2bfpB           VIFLCSSKAKYIT---------------
3cxtA           AVFLASDASNFVN---------------
3ctmA           YLYLASNASTFTT---------------
3e9nD           ----------------------------
3e5mA           VLSLLKMPEKY-----------------
1adeA           ----------------------------
2cukA           ----------------------------
2bfaB           VIFLCSSKAKYIT---------------
2a35A           VRFVESDELRKLG---------------
3e9qB           --LWLGDDSRRKT---------------
2e6eD           ----------------------------
1cg4A           VAYRMPDGRE------------------
3d7lF           ARAFEKSVFGAQT---------------
1e7wA           VIFLCSSKAKYIT---------------
3e9nH           ----------------------------
3bmeB           VIFLVSGSAQYIT---------------
3d5tC           ----------------------------
3d3jA           ----------------------------
3e9nF           ----------------------------
1e92C           VIFLCSSKAKYIT---------------
2c5aA           ----------------------------
2e6eB           R-WAVAQGFVSAT---------------
3dtdB           ----------------------------
2bf7B           VIFLCSSKAKYIT---------------
3dfzB           ----------------------------
2eggA           ----------------------------
1e6uA           ----------------------------
1a7aB           ----------------------------
3dooA           ----------------------------
2e6gJ           GTDRWAVAQGFVS---------------
1a4iA           ----------------------------
1a4iB           ----------------------------
1e92B           VIFLCSSKAKYIT---------------
2bfaC           VIFLCSSKAKYIT---------------
3donA           ----------------------------
2eezA           ----------------------------
2bfmC           VIFLCSSKAKYIT---------------
2bf7C           VIFLCSSKAKYIT---------------
3bywC           ----------------------------
2a35B           ----------------------------
2bkaA           MLNNVVRPRD------------------
3e8xA           IAELVDQQHTI-----------------
3bywB           ----------------------------
1b0aA           ----------------------------
2e6gG           ----------------------------
3dqpA           IKELVTDHSI------------------
1civA           ----------------------------
3bywF           ----------------------------
1d0iA           ----------------------------
3e48B           ----------------------------
1ek6B           ----------------------------
2dt8A           ----------------------------
2ef0A           ----------------------------
3eheA           ----------------------------
2e6gB           ----------------------------
1e7rA           ----------------------------
1a7aA           ----------------------------
1buaA           ----------------------------
2c29D           ----------------------------
2b69A           ----------------------------
3bywD           ----------------------------
1db3A           ----------------------------
1ddtA           GELVDIG---------------------
3d5tA           ----------------------------
1arzB           ----------------------------
3bywH           ----------------------------
2e6gF           ----------------------------
1a2zA           ----------------------------
3dtdA           ----------------------------