[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09080.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "3ce6B.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "3ch6E.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "1dj2A.bssp"
#ERROR : Can't open dsspfile "3d3eA.bssp"
#ERROR : Can't open dsspfile "3deyX.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "3ce6A.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "3bzuB.bssp"
#ERROR : Can't open dsspfile "3d5qC.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "3czrA.bssp"
#ERROR : Can't open dsspfile "3dwfB.bssp"
#ERROR : Can't open dsspfile "2aw5C.bssp"
#ERROR : Can't open dsspfile "3dwfA.bssp"
#ERROR : Can't open dsspfile "3dwfC.bssp"
#ERROR : Can't open dsspfile "3d3wA.bssp"
#ERROR : Can't open dsspfile "2a4kA.bssp"
#ERROR : Can't open dsspfile "2belA.bssp"
#ERROR : Can't open dsspfile "2e6hD.bssp"
#ERROR : Can't open dsspfile "3ce6D.bssp"
#ERROR : Can't open dsspfile "3bmoB.bssp"
#ERROR : Can't open dsspfile "2aw5B.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "3d5qD.bssp"
#ERROR : Can't open dsspfile "1bmdA.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "2belB.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "3bhmA.bssp"
#ERROR : Can't open dsspfile "3csdB.bssp"
#ERROR : Can't open dsspfile "2aqiA.bssp"
#ERROR : Can't open dsspfile "3ch6D.bssp"
#ERROR : Can't open dsspfile "2ag5A.bssp"
#ERROR : Can't open dsspfile "2b35A.bssp"
#ERROR : Can't open dsspfile "1c9yA.bssp"
#ERROR : Can't open dsspfile "2e6gK.bssp"
#ERROR : Can't open dsspfile "2e6cC.bssp"
#ERROR : Can't open dsspfile "2belD.bssp"
#ERROR : Can't open dsspfile "1dfiA.bssp"
#ERROR : Can't open dsspfile "3ek2A.bssp"
#ERROR : Can't open dsspfile "3ctmH.bssp"
#ERROR : Can't open dsspfile "2b35E.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "1c3vA.bssp"
#ERROR : Can't open dsspfile "2ehdB.bssp"
#ERROR : Can't open dsspfile "2e6hB.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "3d5qB.bssp"
#ERROR : Can't open dsspfile "1edoA.bssp"
#ERROR : Can't open dsspfile "3e03C.bssp"
#ERROR : Can't open dsspfile "3e03B.bssp"
#ERROR : Can't open dsspfile "2ehdA.bssp"
#ERROR : Can't open dsspfile "3ek2D.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "1bxkB.bssp"
#ERROR : Can't open dsspfile "2dfdA.bssp"
#ERROR : Can't open dsspfile "1d7oA.bssp"
#ERROR : Can't open dsspfile "3byzA.bssp"
#ERROR : Can't open dsspfile "2a4kB.bssp"
#ERROR : Can't open dsspfile "2dknA.bssp"
#ERROR : Can't open dsspfile "3c6cA.bssp"
#ERROR : Can't open dsspfile "3d3uA.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "3d4nB.bssp"
#ERROR : Can't open dsspfile "3d4nC.bssp"
#ERROR : Can't open dsspfile "3ek2C.bssp"
#ERROR : Can't open dsspfile "2ag5B.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "3ch6A.bssp"
#ERROR : Can't open dsspfile "3bzuA.bssp"
#ERROR : Can't open dsspfile "3e48A.bssp"
#ERROR : Can't open dsspfile "2ag5C.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3dfzA.bssp"
#ERROR : Can't open dsspfile "2ae2A.bssp"
#ERROR : Can't open dsspfile "1bhsA.bssp"
#ERROR : Can't open dsspfile "3dxfB.bssp"
#ERROR : Can't open dsspfile "3cq0B.bssp"
#ERROR : Can't open dsspfile "3bmeC.bssp"
#ERROR : Can't open dsspfile "3bzuD.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "3d3eB.bssp"
#ERROR : Can't open dsspfile "3d4nD.bssp"
#ERROR : Can't open dsspfile "2e6hC.bssp"
#ERROR : Can't open dsspfile "2e6bD.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "2e6cD.bssp"
#ERROR : Can't open dsspfile "2ekpA.bssp"
#ERROR : Can't open dsspfile "3ek2B.bssp"
#ERROR : Can't open dsspfile "2e6bC.bssp"
#ERROR : Can't open dsspfile "3dooA.bssp"
#ERROR : Can't open dsspfile "2e6gA.bssp"
#ERROR : Can't open dsspfile "1d4gA.bssp"
#ERROR : Can't open dsspfile "1di7A.bssp"
#ERROR : Can't open dsspfile "1dj3A.bssp"
#ERROR : Can't open dsspfile "3c2qA.bssp"
#ERROR : Can't open dsspfile "3edmA.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "2ekqD.bssp"
#ERROR : Can't open dsspfile "1ae1B.bssp"
#ERROR : Can't open dsspfile "3d5qA.bssp"
#ERROR : Can't open dsspfile "2c5aB.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "2e6eB.bssp"
#ERROR : Can't open dsspfile "2aqkA.bssp"
#ERROR : Can't open dsspfile "2aqhA.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "2b4qA.bssp"
#ERROR : Can't open dsspfile "3d7lA.bssp"
#ERROR : Can't open dsspfile "3ctmD.bssp"
#ERROR : Can't open dsspfile "1e3sA.bssp"
#ERROR : Can't open dsspfile "2c54B.bssp"
#ERROR : Can't open dsspfile "3e03A.bssp"
#ERROR : Can't open dsspfile "1e6wD.bssp"
#ERROR : Can't open dsspfile "2aw5A.bssp"
#ERROR : Can't open dsspfile "1e7sA.bssp"
#ERROR : Can't open dsspfile "2b37C.bssp"
#ERROR : Can't open dsspfile "2eggA.bssp"
#ERROR : Can't open dsspfile "2dknB.bssp"
#ERROR : Can't open dsspfile "2a92C.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "2e6eD.bssp"
#ERROR : Can't open dsspfile "1e7qA.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "2c5eB.bssp"
#ERROR : Can't open dsspfile "3cxrA.bssp"
#ERROR : Can't open dsspfile "2e37D.bssp"
#ERROR : Can't open dsspfile "3ctmE.bssp"
#ERROR : Can't open dsspfile "3c2qB.bssp"
#ERROR : Can't open dsspfile "2aq8A.bssp"
#ERROR : Can't open dsspfile "2b36B.bssp"
#ERROR : Can't open dsspfile "3d7lD.bssp"
#ERROR : Can't open dsspfile "3bmnD.bssp"
#ERROR : Can't open dsspfile "2eghA.bssp"
#ERROR : Can't open dsspfile "1e3wA.bssp"
#ERROR : Can't open dsspfile "2dteA.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "1c9kB.bssp"
#ERROR : Can't open dsspfile "3donA.bssp"
#ERROR : Can't open dsspfile "2b35C.bssp"
#ERROR : Can't open dsspfile "3diiA.bssp"
#ERROR : Can't open dsspfile "2c07A.bssp"
#ERROR : Can't open dsspfile "2b35D.bssp"
#ERROR : Can't open dsspfile "3ctmG.bssp"
#ERROR : Can't open dsspfile "1e7wA.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "3d64A.bssp"
#ERROR : Can't open dsspfile "1cbuC.bssp"
#ERROR : Can't open dsspfile "2b35B.bssp"
#ERROR : Can't open dsspfile "3d4nA.bssp"
#ERROR : Can't open dsspfile "3e6vA.bssp"
#ERROR : Can't open dsspfile "1e6wA.bssp"
#ERROR : Can't open dsspfile "2c59A.bssp"
#ERROR : Can't open dsspfile "3cxtA.bssp"
#ERROR : Can't open dsspfile "2axqA.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "2bf7A.bssp"
#ERROR : Can't open dsspfile "3ctmA.bssp"
#ERROR : Can't open dsspfile "3e9qB.bssp"
#ERROR : Can't open dsspfile "2bd0A.bssp"
#ERROR : Can't open dsspfile "1e6wB.bssp"
#ERROR : Can't open dsspfile "1bdmA.bssp"
#ERROR : Can't open dsspfile "3ctmC.bssp"
#ERROR : Can't open dsspfile "2c7vD.bssp"
#ERROR : Can't open dsspfile "1cydA.bssp"
#ERROR : Can't open dsspfile "2bfaA.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "3edmC.bssp"
#ERROR : Can't open dsspfile "1cg1A.bssp"
#ERROR : Can't open dsspfile "2bfpB.bssp"
#ERROR : Can't open dsspfile "1e92A.bssp"
#ERROR : Can't open dsspfile "2c54A.bssp"
#ERROR : Can't open dsspfile "2bfmB.bssp"
#ERROR : Can't open dsspfile "2bfoA.bssp"
#ERROR : Can't open dsspfile "2bfaB.bssp"
#ERROR : Can't open dsspfile "2a92B.bssp"
#ERROR : Can't open dsspfile "2cukA.bssp"
#ERROR : Can't open dsspfile "2c7vA.bssp"
#ERROR : Can't open dsspfile "2c7vB.bssp"
#ERROR : Can't open dsspfile "3bmnC.bssp"
#ERROR : Can't open dsspfile "3edmD.bssp"
#ERROR : Can't open dsspfile "2e6gJ.bssp"
#ERROR : Can't open dsspfile "3bmqC.bssp"
#ERROR : Can't open dsspfile "2b35F.bssp"
#ERROR : Can't open dsspfile "2bf7B.bssp"
#ERROR : Can't open dsspfile "2e37C.bssp"
#ERROR : Can't open dsspfile "3dijA.bssp"
#ERROR : Can't open dsspfile "1e7wB.bssp"
#ERROR : Can't open dsspfile "1buaB.bssp"
#ERROR : Can't open dsspfile "3bmqA.bssp"
#ERROR : Can't open dsspfile "1d4fA.bssp"
#ERROR : Can't open dsspfile "1a7aB.bssp"
#ERROR : Can't open dsspfile "1b3rA.bssp"
#ERROR : Can't open dsspfile "1cg3A.bssp"
#ERROR : Can't open dsspfile "3bmoD.bssp"
#ERROR : Can't open dsspfile "3bmfB.bssp"
#ERROR : Can't open dsspfile "2c59B.bssp"
#ERROR : Can't open dsspfile "2c82A.bssp"
#ERROR : Can't open dsspfile "3bmiB.bssp"
#ERROR : Can't open dsspfile "3bmkC.bssp"
#ERROR : Can't open dsspfile "1e92B.bssp"
#ERROR : Can't open dsspfile "3bmeB.bssp"
#ERROR : Can't open dsspfile "2e37B.bssp"
#ERROR : Can't open dsspfile "2e37A.bssp"
#ERROR : Can't open dsspfile "3bmdB.bssp"
#ERROR : Can't open dsspfile "1c9kA.bssp"
#ERROR : Can't open dsspfile "1e6wC.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "3dtdB.bssp"
#ERROR : Can't open dsspfile "1a7aA.bssp"
#ERROR : Can't open dsspfile "1bdmB.bssp"
#ERROR : Can't open dsspfile "3bzuC.bssp"
#ERROR : Can't open dsspfile "3d7lB.bssp"
#ERROR : Can't open dsspfile "3bmfC.bssp"
#ERROR : Can't open dsspfile "2bfaD.bssp"
#ERROR : Can't open dsspfile "3d7lF.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "1ek5A.bssp"
#ERROR : Can't open dsspfile "3bmfA.bssp"
#ERROR : Can't open dsspfile "3dhnA.bssp"
#ERROR : Can't open dsspfile "3bmoA.bssp"
#ERROR : Can't open dsspfile "3bmnB.bssp"
#ERROR : Can't open dsspfile "3bmoC.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "2c7vC.bssp"
#ERROR : Can't open dsspfile "3bmjD.bssp"
#ERROR : Can't open dsspfile "3bmfD.bssp"
#ERROR : Can't open dsspfile "2b37B.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "2bfaC.bssp"
#ERROR : Can't open dsspfile "2eezA.bssp"
#ERROR : Can't open dsspfile "3dbhC.bssp"
#ERROR : Can't open dsspfile "2bf7D.bssp"
#ERROR : Can't open dsspfile "3d3jA.bssp"
#ERROR : Can't open dsspfile "1e92D.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "1a4iB.bssp"
#ERROR : Can't open dsspfile "2a92A.bssp"
#ERROR : Can't open dsspfile "3bmeA.bssp"
#ERROR : Can't open dsspfile "2e6gB.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "1cg4A.bssp"
#ERROR : Can't open dsspfile "2c5aA.bssp"
#ERROR : Can't open dsspfile "2bfoC.bssp"
#ERROR : Can't open dsspfile "2bfmC.bssp"
#ERROR : Can't open dsspfile "3dfzB.bssp"
#ERROR : Can't open dsspfile "1bwsA.bssp"
#ERROR : Can't open dsspfile "3bmnA.bssp"
#ERROR : Can't open dsspfile "1a4iA.bssp"
#ERROR : Can't open dsspfile "2e6gG.bssp"
#ERROR : Can't open dsspfile "3e9nA.bssp"
#ERROR : Can't open dsspfile "1e92C.bssp"
#ERROR : Can't open dsspfile "2bfpD.bssp"
#ERROR : Can't open dsspfile "2ef0A.bssp"
#ERROR : Can't open dsspfile "1edzA.bssp"
#ERROR : Can't open dsspfile "2bf7C.bssp"
#ERROR : Can't open dsspfile "3e9nC.bssp"
#ERROR : Can't open dsspfile "3e9nB.bssp"
#ERROR : Can't open dsspfile "1civA.bssp"
#ERROR : Can't open dsspfile "3e9nD.bssp"
#ERROR : Can't open dsspfile "1e6uA.bssp"
#ERROR : Can't open dsspfile "3dqpA.bssp"
#ERROR : Can't open dsspfile "1b0aA.bssp"
#ERROR : Can't open dsspfile "2c20A.bssp"
#ERROR : Can't open dsspfile "2bkaA.bssp"
#ERROR : Can't open dsspfile "2a35A.bssp"
#ERROR : Can't open dsspfile "3dtdA.bssp"
#ERROR : Can't open dsspfile "3e9nE.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "3e8xA.bssp"
#ERROR : Can't open dsspfile "1ddtA.bssp"
#ERROR : Can't open dsspfile "3e9nH.bssp"
#ERROR : Can't open dsspfile "2e6gF.bssp"
#ERROR : Can't open dsspfile "3ejxD.bssp"
#ERROR : Can't open dsspfile "2dt8A.bssp"
#ERROR : Can't open dsspfile "3dxfA.bssp"
#ERROR : Can't open dsspfile "3e9nF.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "3bywC.bssp"
#ERROR : Can't open dsspfile "1b93A.bssp"

## Summary of PDB Search
:264
    5e-39  21%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    6e-36  21%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    4e-34  10%  3ce6B  [x.x.x] ADENOSYLHOMOCYSTEINASE
    8e-34  27%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    2e-33  21%  3ch6E  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-32  10%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    9e-32   7%  1dj2A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    1e-31  22%  3d3eA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-31  27%  3deyX  [x.x.x] ESTRADIOL 17-BETA-DEHYDROGENASE 1
    6e-31  33%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-30  21%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-30  11%  3ce6A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    2e-30   7%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    4e-30  20%  3bzuB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-30  22%  3d5qC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-30  34%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-29  21%  3czrA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-28  18%  3dwfB  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    2e-28   9%  2aw5C  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    5e-28  22%  3dwfA  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    1e-27  21%  3dwfC  [x.x.x] 11-BETA-HYDROXYSTEROID DEHYDROGENASE 1
    3e-27  26%  3d3wA  [x.x.x] L-XYLULOSE REDUCTASE
    1e-26  32%  2a4kA  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    1e-26  22%  2belA  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-26   9%  2e6hD  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-26   9%  3ce6D  [x.x.x] ADENOSYLHOMOCYSTEINASE
    4e-26  21%  3bmoB  [x.x.x] PTERIDINE REDUCTASE
    6e-26   8%  2aw5B  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    8e-26  20%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    8e-26  22%  3d5qD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-25   7%  1bmdA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    5e-25  18%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    5e-25  20%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    5e-25  22%  2belB  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-25  33%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    6e-25  18%  3bhmA  [x.x.x] CARBONYL REDUCTASE [NADPH] 1
    7e-25  36%  3csdB  [x.x.x] PUTATIVE KETOACYL REDUCTASE
    8e-25  15%  2aqiA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-24  22%  3ch6D  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-24  22%  2ag5A  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    8e-24  14%  2b35A  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    9e-24   7%  1c9yA  [c.78.1 - c.78.1] ORNITHINE CARBAMOYLTRANSFERASE
    9e-24  11%  2e6gK  [x.x.x] 5'-NUCLEOTIDASE SURE
    9e-24   8%  2e6cC  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-23  22%  2belD  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    1e-23  18%  1dfiA  [c.2.1] ENOYL ACYL CARRIER PROTEIN REDUCTASE
    2e-23  18%  3ek2A  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-23  19%  3ctmH  [x.x.x] CARBONYL REDUCTASE
    7e-23  15%  2b35E  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    8e-23   9%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    9e-23   8%  1c3vA  [c.2.1 - d.81.1] DIHYDRODIPICOLINATE REDUCTASE
    2e-22  28%  2ehdB  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    2e-22  11%  2e6hB  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-22  33%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    3e-22  20%  3d5qB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-22  39%  1edoA  [c.2.1] BETA-KETO ACYL CARRIER PROTEIN REDUCTASE
    4e-22  24%  3e03C  [x.x.x] SHORT CHAIN DEHYDROGENASE
    5e-22  24%  3e03B  [x.x.x] SHORT CHAIN DEHYDROGENASE
    6e-22  29%  2ehdA  [x.x.x] OXIDOREDUCTASE, SHORT-CHAIN
    7e-22  17%  3ek2D  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    7e-22  27%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
    1e-21  19%  1c14A  [c.2.1] ENOYL REDUCTASE
    2e-21   7%  1bxkB  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    2e-21  12%  2dfdA  [x.x.x] MALATE DEHYDROGENASE
    3e-21  20%  1d7oA  [c.2.1] ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH)
    4e-21  22%  3byzA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-21  38%  2a4kB  [x.x.x] 3-OXOACYL-[ACYL CARRIER PROTEIN] REDUCTASE
    6e-21  23%  2dknA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    8e-21  10%  3c6cA  [x.x.x] 3-KETO-5-AMINOHEXANOATE CLEAVAGE ENZYME
    8e-21  10%  3d3uA  [x.x.x] 4-HYDROXYBUTYRATE COA-TRANSFERASE
    9e-21   8%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-20  28%  1ahhA  [c.2.1] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    2e-20  21%  3d4nB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-20  21%  3d4nC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-20  19%  3ek2C  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    2e-20  21%  2ag5B  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    3e-20  21%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-20  20%  3ch6A  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-20  21%  3bzuA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    5e-20   5%  3e48A  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    7e-20  21%  2ag5C  [x.x.x] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6
    1e-19   6%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    1e-19   4%  3dfzA  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    1e-19  29%  2ae2A  [c.2.1] PROTEIN (TROPINONE REDUCTASE-II)
    2e-19  27%  1bhsA  [c.2.1 (1dhtA)] 17BETA-HYDROXYSTEROID DEHYDROGENASE
    2e-19   9%  3dxfB  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    2e-19   5%  3cq0B  [x.x.x] PUTATIVE TRANSALDOLASE YGR043C
    2e-19  22%  3bmeC  [x.x.x] PTERIDINE REDUCTASE
    2e-19  22%  3bzuD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-19  24%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    3e-19  21%  1dohA  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-19  21%  3d3eB  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    3e-19  22%  3d4nD  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-19  12%  2e6hC  [x.x.x] 5'-NUCLEOTIDASE SURE
    6e-19  10%  2e6bD  [x.x.x] 5'-NUCLEOTIDASE SURE
    6e-19  18%  1dhrA  [c.2.1 (1dirA)] DIHYDROPTERIDINE REDUCTASE
    7e-19  11%  2e6cD  [x.x.x] 5'-NUCLEOTIDASE SURE
    7e-19  38%  2ekpA  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    8e-19  22%  3ek2B  [x.x.x] ENOYL-(ACYL-CARRIER-PROTEIN) REDUCTASE (NADH)
    9e-19  10%  2e6bC  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-18   7%  3dooA  [x.x.x] SHIKIMATE DEHYDROGENASE
    1e-18  13%  2e6gA  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-18  11%  1d4gA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    2e-18  12%  1di7A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    2e-18   7%  1dj3A  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    2e-18  10%  3c2qA  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    2e-18  29%  3edmA  [x.x.x] SHORT CHAIN DEHYDROGENASE
    3e-18   9%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    3e-18  33%  2ekqD  [x.x.x] 2-DEOXY-D-GLUCONATE 3-DEHYDROGENASE
    3e-18  30%  1ae1B  [c.2.1] TROPINONE REDUCTASE-I
    3e-18  21%  3d5qA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-18   6%  2c5aB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-18  23%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    5e-18   8%  2e6eB  [x.x.x] 5'-NUCLEOTIDASE SURE
    6e-18  16%  2aqkA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-17  14%  2aqhA  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    1e-17  21%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    2e-17  27%  2b4qA  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    2e-17  15%  3d7lA  [x.x.x] LIN1944 PROTEIN
    2e-17  24%  3ctmD  [x.x.x] CARBONYL REDUCTASE
    3e-17  21%  1e3sA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-17   5%  2c54B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    3e-17  25%  3e03A  [x.x.x] SHORT CHAIN DEHYDROGENASE
    4e-17  20%  1e6wD  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    4e-17  11%  2aw5A  [x.x.x] NADP-DEPENDENT MALIC ENZYME
    5e-17   7%  1e7sA  [c.2.1] GDP-FUCOSE SYNTHETASE
    5e-17  14%  2b37C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-17  10%  2eggA  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    6e-17  26%  2dknB  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-17   9%  2a92C  [x.x.x] L-LACTATE DEHYDROGENASE
    8e-17  30%  1ae1A  [c.2.1] TROPINONE REDUCTASE-I
    1e-16   9%  2e6eD  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-16   9%  1e7qA  [c.2.1] GDP-FUCOSE SYNTHETASE
    2e-16  21%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    2e-16   7%  2c5eB  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    2e-16  25%  3cxrA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    2e-16  13%  2e37D  [x.x.x] L-LACTATE DEHYDROGENASE
    3e-16  21%  3ctmE  [x.x.x] CARBONYL REDUCTASE
    4e-16  12%  3c2qB  [x.x.x] UNCHARACTERIZED CONSERVED PROTEIN
    4e-16  15%  2aq8A  [x.x.x] ENOYL-ACYL-CARRIER-PROTEIN REDUCTASE
    4e-16  15%  2b36B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-16  15%  3d7lD  [x.x.x] LIN1944 PROTEIN
    5e-16  31%  3bmnD  [x.x.x] PTERIDINE REDUCTASE
    5e-16   9%  2eghA  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    5e-16  20%  1e3wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    6e-16  36%  2dteA  [x.x.x] GLUCOSE 1-DEHYDROGENASE RELATED PROTEIN
    1e-15   6%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    1e-15  11%  1c9kB  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    1e-15   5%  3donA  [x.x.x] SHIKIMATE DEHYDROGENASE
    2e-15  14%  2b35C  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-15  24%  3diiA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-15  35%  2c07A  [x.x.x] 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
    2e-15  14%  2b35D  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-15  21%  3ctmG  [x.x.x] CARBONYL REDUCTASE
    2e-15  25%  1e7wA  [c.2.1] PTERIDINE REDUCTASE
    3e-15  30%  1bdbA  [x.x.x] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    4e-15  12%  3d64A  [x.x.x] ADENOSYLHOMOCYSTEINASE
    4e-15  13%  1cbuC  [c.37.1] ADENOSYLCOBINAMIDE KINASE/ADENOSYLCOBINAMIDE
    4e-15  15%  2b35B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    5e-15  23%  3d4nA  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    6e-15  13%  3e6vA  [x.x.x] ARGINASE-1
    7e-15  27%  1e6wA  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    8e-15   5%  2c59A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    8e-15  29%  3cxtA  [x.x.x] DEHYDROGENASE WITH DIFFERENT SPECIFICITIES
    8e-15   8%  2axqA  [x.x.x] SACCHAROPINE DEHYDROGENASE
    1e-14   8%  1a9yA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    1e-14  26%  2bf7A  [x.x.x] PTERIDINE REDUCTASE 1
    1e-14  22%  3ctmA  [x.x.x] CARBONYL REDUCTASE
    1e-14  17%  3e9qB  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    1e-14  24%  2bd0A  [x.x.x] SEPIAPTERIN REDUCTASE
    1e-14  29%  1e6wB  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    1e-14   9%  1bdmA  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    1e-14  22%  3ctmC  [x.x.x] CARBONYL REDUCTASE
    1e-14  31%  2c7vD  [x.x.x] PTERIDINE REDUCTASE
    2e-14  22%  1cydA  [c.2.1] CARBONYL REDUCTASE
    2e-14  26%  2bfaA  [x.x.x] PTERIDINE REDUCTASE 1
    2e-14   8%  1bsvA  [c.2.1] PROTEIN (GDP-FUCOSE SYNTHETASE)
    2e-14  26%  3edmC  [x.x.x] SHORT CHAIN DEHYDROGENASE
    2e-14  11%  1cg1A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    2e-14  26%  2bfpB  [x.x.x] PTERIDINE REDUCTASE 1
    2e-14  26%  1e92A  [c.2.1] PTERIDINE REDUCTASE 1
    2e-14   6%  2c54A  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    3e-14  27%  2bfmB  [x.x.x] PTERIDINE REDUCTASE 1
    3e-14  28%  2bfoA  [x.x.x] PTERIDINE REDUCTASE 1
    5e-14  26%  2bfaB  [x.x.x] PTERIDINE REDUCTASE 1
    5e-14   6%  2a92B  [x.x.x] L-LACTATE DEHYDROGENASE
    8e-14  12%  2cukA  [x.x.x] GLYCERATE DEHYDROGENASE/GLYOXYLATE REDUCTASE
    1e-13  32%  2c7vA  [x.x.x] PTERIDINE REDUCTASE
    1e-13  31%  2c7vB  [x.x.x] PTERIDINE REDUCTASE
    1e-13  31%  3bmnC  [x.x.x] PTERIDINE REDUCTASE
    1e-13  25%  3edmD  [x.x.x] SHORT CHAIN DEHYDROGENASE
    1e-13  12%  2e6gJ  [x.x.x] 5'-NUCLEOTIDASE SURE
    1e-13  29%  3bmqC  [x.x.x] PTERIDINE REDUCTASE
    2e-13  15%  2b35F  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    2e-13  25%  2bf7B  [x.x.x] PTERIDINE REDUCTASE 1
    2e-13  14%  2e37C  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-13  22%  3dijA  [x.x.x] SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    2e-13  27%  1e7wB  [c.2.1] PTERIDINE REDUCTASE
    3e-13   9%  1buaB  [c.52.1] ENDONUCLEASE ECORV
    3e-13  31%  3bmqA  [x.x.x] PTERIDINE REDUCTASE
    4e-13  10%  1d4fA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    4e-13   8%  1a7aB  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    4e-13  12%  1b3rA  [c.23.12 - c.2.1] PROTEIN (S-ADENOSYLHOMOCYSTEINE HYDROLASE)
    5e-13  10%  1cg3A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    5e-13  29%  3bmoD  [x.x.x] PTERIDINE REDUCTASE
    5e-13  31%  3bmfB  [x.x.x] PTERIDINE REDUCTASE
    7e-13   6%  2c59B  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    8e-13   7%  2c82A  [x.x.x] 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
    8e-13  30%  3bmiB  [x.x.x] PTERIDINE REDUCTASE
    8e-13  31%  3bmkC  [x.x.x] PTERIDINE REDUCTASE
    1e-12  26%  1e92B  [c.2.1] PTERIDINE REDUCTASE 1
    2e-12  31%  3bmeB  [x.x.x] PTERIDINE REDUCTASE
    2e-12  10%  2e37B  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-12  11%  2e37A  [x.x.x] L-LACTATE DEHYDROGENASE
    2e-12  30%  3bmdB  [x.x.x] PTERIDINE REDUCTASE
    2e-12  12%  1c9kA  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    3e-12  27%  1e6wC  [c.2.1] SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
    3e-12  10%  1di6A  [c.57.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    3e-12  11%  3dtdB  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    3e-12   9%  1a7aA  [c.23.12 - c.2.1] S-ADENOSYLHOMOCYSTEINE HYDROLASE
    3e-12  12%  1bdmB  [c.2.1 - d.162.1] MALATE DEHYDROGENASE
    3e-12  22%  3bzuC  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    4e-12  15%  3d7lB  [x.x.x] LIN1944 PROTEIN
    4e-12  31%  3bmfC  [x.x.x] PTERIDINE REDUCTASE
    4e-12  28%  2bfaD  [x.x.x] PTERIDINE REDUCTASE 1
    7e-12  18%  3d7lF  [x.x.x] LIN1944 PROTEIN
    7e-12  14%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    9e-12   9%  1ek5A  [c.2.1] UDP-GALACTOSE 4-EPIMERASE
    9e-12  29%  3bmfA  [x.x.x] PTERIDINE REDUCTASE
    1e-11  11%  3dhnA  [x.x.x] NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    1e-11  29%  3bmoA  [x.x.x] PTERIDINE REDUCTASE
    2e-11  30%  3bmnB  [x.x.x] PTERIDINE REDUCTASE
    2e-11  31%  3bmoC  [x.x.x] PTERIDINE REDUCTASE
    2e-11  12%  1adeA  [c.37.1] ADENYLOSUCCINATE SYNTHETASE
    3e-11  30%  2c7vC  [x.x.x] PTERIDINE REDUCTASE
    3e-11  30%  3bmjD  [x.x.x] PTERIDINE REDUCTASE
    4e-11  30%  3bmfD  [x.x.x] PTERIDINE REDUCTASE
    4e-11  17%  2b37B  [x.x.x] ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
    6e-11  16%  1d0iA  [c.23.13] TYPE II 3-DEHYDROQUINATE HYDRATASE
    6e-11  29%  2bfaC  [x.x.x] PTERIDINE REDUCTASE 1
    7e-11   9%  2eezA  [x.x.x] ALANINE DEHYDROGENASE
    9e-11   8%  3dbhC  [x.x.x] NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT
    1e-10  29%  2bf7D  [x.x.x] PTERIDINE REDUCTASE 1
    1e-10   9%  3d3jA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-10  29%  1e92D  [c.2.1] PTERIDINE REDUCTASE 1
    2e-10  21%  1a4uA  [c.2.1] ALCOHOL DEHYDROGENASE
    3e-10  11%  1a4iB  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    3e-10   7%  2a92A  [x.x.x] L-LACTATE DEHYDROGENASE
    3e-10  30%  3bmeA  [x.x.x] PTERIDINE REDUCTASE
    3e-10  13%  2e6gB  [x.x.x] 5'-NUCLEOTIDASE SURE
    3e-10   5%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    4e-10  16%  1cg4A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    5e-10   7%  2c5aA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    5e-10  30%  2bfoC  [x.x.x] PTERIDINE REDUCTASE 1
    5e-10  30%  2bfmC  [x.x.x] PTERIDINE REDUCTASE 1
    6e-10   9%  3dfzB  [x.x.x] PRECORRIN-2 DEHYDROGENASE
    6e-10  11%  1bwsA  [c.2.1] PROTEIN (GDP-4-KETO-6-DEOXY-D-MANNOSE
    1e-09  29%  3bmnA  [x.x.x] PTERIDINE REDUCTASE
    1e-09  14%  1a4iA  [c.58.1 - c.2.1] METHYLENETETRAHYDROFOLATE DEHYDROGENASE /
    2e-09  14%  2e6gG  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-09  30%  3e9nA  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    3e-09  28%  1e92C  [c.2.1] PTERIDINE REDUCTASE 1
    6e-09  30%  2bfpD  [x.x.x] PTERIDINE REDUCTASE 1
    6e-09  13%  2ef0A  [x.x.x] ORNITHINE CARBAMOYLTRANSFERASE
    8e-09   4%  1edzA  [c.58.1 - c.2.1] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE
    1e-08  29%  2bf7C  [x.x.x] PTERIDINE REDUCTASE 1
    1e-08  29%  3e9nC  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    5e-08  21%  3e9nB  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    5e-08   6%  1civA  [c.2.1 - d.162.1] NADP-MALATE DEHYDROGENASE
    1e-07  32%  3e9nD  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    1e-07   9%  1e6uA  [c.2.1] GDP-FUCOSE SYNTHETASE
    1e-07  11%  3dqpA  [x.x.x] OXIDOREDUCTASE YLBE
    1e-07  14%  1b0aA  [c.58.1 - c.2.1] PROTEIN (FOLD BIFUNCTIONAL PROTEIN)
    3e-07   7%  2c20A  [x.x.x] UDP-GLUCOSE 4-EPIMERASE
    4e-07   9%  2bkaA  [x.x.x] TAT-INTERACTING PROTEIN TIP30
    7e-07  14%  2a35A  [x.x.x] HYPOTHETICAL PROTEIN PA4017
    7e-07   6%  3dtdA  [x.x.x] INVASION-ASSOCIATED PROTEIN B
    8e-07  35%  3e9nE  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    8e-07  13%  1bw3A  [x.x.x] BARWIN, BASIC BARLEY SEED PROTEIN
    1e-06  20%  3e8xA  [x.x.x] PUTATIVE NAD-DEPENDENT EPIMERASE/DEHYDRATASE
    2e-06   9%  1ddtA  [d.166.1 - f.1.2 - b.2.1 (1mdtA)] DIPHTHERIA TOXIN
    2e-06  35%  3e9nH  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    7e-06  12%  2e6gF  [x.x.x] 5'-NUCLEOTIDASE SURE
    2e-05  14%  3ejxD  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    3e-05  11%  2dt8A  [x.x.x] DEGV FAMILY PROTEIN
    4e-05   9%  3dxfA  [x.x.x] NMRA-LIKE FAMILY DOMAIN-CONTAINING PROTEIN 1
    5e-05  28%  3e9nF  [x.x.x] PUTATIVE SHORT-CHAIN DEHYDROGENASE/REDUCTASE
    7e-04   5%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    7e-04  12%  3bywC  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    8e-04  12%  1b93A  [c.24.1] PROTEIN (METHYLGLYOXAL SYNTHASE)
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGNALQGRHALVTXXXXXXXXXXXXXXXXXXXSVTLLGREQAALDATVHALQSCVIEGAALGAVSADITD
1a27A           ------RTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAAALACPPGSLETLQLDV
1dohB           ----LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKK--NGSDAACVKANVGV
3ce6B           -----------------------------------------------------------------DIVVT
2ae1A           ----LEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRS---KGFKVEASVCDLSS
3ch6E           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
1a9zA           -------------------------------------GHDVIILDNLCNSKRSVLPVIERLGTFVEGDIR
1dj2A           ----SELAKSFIGTTKRGIGPAYSSKVIRNGIRVGDLRHMDTLPQKLDLLLSDAAAR------FQGFKYT
3d3eA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEL--GAASAHYIAGTMED
3deyX           --------------------------------------RDLKTQGRLWEAARALACPPGSLETLQLDVRD
2d1yB           ----FAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGA---------FFQVDLED
2belC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
3ce6A           ---------------------------------VSVTEIDPINALQAMMEGFDVVTVEEAI-GDADIVVT
2cnbB           ------HMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVETDGPKPPWADRYAALEVG
3bzuB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELG--AASAHYIAGTMED
3d5qC           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEL--GAASAHYIAGTMED
2d1yA           ----FAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE---------AIGGAFFQVDLED
3czrA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE--LGAASAHYIAGTMED
3dwfB           PEM-LQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAH--YIAGSMED
2aw5C           ------------------------------------------------KKIWLVDSKGLIVKGQEKEKFA
3dwfA           ----LQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARC--LELGAASAHYIAGSMED
3dwfC           ----LQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARC--LELGAASAHYIAGSMED
3d3wA           MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLD-----------SLVRECPGIEPVCV
2a4kA           ----LSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAI------AVVADVSD
2belA           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEL--GAASAHYIAGTMED
2e6hD           ---------------------------------ILVTNDDGIYSPGLWALAEAASQFGEVF-VAAPDTAG
3ce6D           ---------------------------------VSVTEIDPINALQAMMEGFDVVTVEEAI-GDADIVVT
3bmoB           ----MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSL-ADELNKERSNTAVVCQADLTN
2aw5B           ---------------------------------------------------------GLIVKGQEKEKFA
3ch6B           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
3d5qD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
1bmdA           -----APVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKAL---EGVVMELEDCAFPL
3e9qA           ----LNDRIILVTGASDGIGREAATYARYGATVILLGRNEEKLRQVASHINEETGRQPQWF-ILDLLTCT
3ctmF           ----LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKT---YGVHSKAYKCNISD
2belB           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
2d1yC           ----FAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE---------AIGGAFFQVDLED
3bhmA           ------------------------------------------------------------------DIDD
3csdB           ----QDSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELREA---GVEADGRTCDVRS
2aqiA           --GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLTQRITDRLPAKAPLLELDVQNEEH
3ch6D           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
2ag5A           MGR-LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQ--------TRVLDVTK
2b35A           --GLLDGKRILVSGIITDSSIAFHIARVAQEQQLVLTGFDRLRLIQRITDRLPAKAPLLE--LDVQNEEH
1c9yA           -----------------------------------------------------------------QYAKE
2e6gK           -------------------------------------------------------IYSPGLWALAEAASQ
2e6cC           ---------------------------------ILVTNDDGIYSPGLWALAEAASQFGEVF-VAAPDTEQ
2belD           ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
1dfiA           ----LSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDI--VLQCDVAE
3ek2A           MGF-LDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSEL--VFPCDVAD
3ctmH           ----LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHL---QKTYGVHSKAYKCNISD
2b35E           ----LDGKRILVSGIITDSSIAFHIARVAQEQGLVLTGFDRLRLIQRITDRLPAKAPLLE--LDVQNEEH
2cnbC           ------HMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVQSDGPKPPWADRYAALEVG
1c3vA           --------------------------------------------------------SLLTDGNTEVVIDF
2ehdB           ----GMKGAVLITGASRGIGEATARLLHAKGYRVGLMARDEKRLQALAAELEGAL-------PLPGDVRE
2e6hB           -------------------------------------------------------IYSPGLWALAEAASQ
2d1yD           ----FAGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAE---------AIGGAFFQVDLED
3d5qB           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVS--HCLELGAASAHYIAGTMED
1edoA           ----------------------------------------------------------------------
3e03C           ----LSGKTLFITGASRGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSAAAAVNAAGALKCDIRE
3e03B           ----LSGKTLFITGASRGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSAAAAVNAAGALKCDIRE
2ehdA           -------GAVLITGASRGIGEATARLLHAKGYRVGLMARDEKRLQALAAELEGAL-------PLPGDVRE
3ek2D           MGF-LDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITEFAAEFGSEL--VFPCDVAD
2cfcA           -------RVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHAYADKVLRVRADADEGD
1c14A           ------------------------------------------------------------------DVAE
1bxkB           --------------------------------------------------------------SERFAFEK
2dfdA           ----------------------------------------------------------------------
1d7oA           -----------------------------------------------------------------YAGSS
3byzA           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAH--YIAGTMED
2a4kB           ----LSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAI------AVVADVSD
2dknA           ---------------------------------VIGIDRGQADIEADLSTPGGRETAVAAV-LDRCGGVL
3c6cA           ----------------------------------------------------------------------
3d3uA           --------------------------------------------------------------EGHKDLGI
2cnbA           ------HMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDHVPKPPWADRYAALEVGDVRN
1ahhA           ----LDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQ---QLGGQAFACRCDITS
3d4nB           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVS--HCLELGAASAHYIAGTMED
3d4nC           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVS--HCLELGAASAHYIAGTMED
3ek2C           MGF-LDGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGDRFKDRITE--FAAEFGSELVFPCDVAD
2ag5B           ----LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQ--------TRVLDVTK
3edmB           ----FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAAT--AVAEIEKLGRSALAIKADLTN
3ch6A           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVS--HCLELGAASAHYIAGTMED
3bzuA           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELG--AASAHYIAGTMED
3e48A           ------------------------------------------------------DDWRGKVSVRQLDYFN
2ag5C           ----LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQ--------TRVLDVTK
1b8pA           -----TPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMM--EIDDCAFP
3dfzA           ----------------------------------------------------------------------
2ae2A           ----------------------------------------------------------------------
1bhsA           ----------------------------------------------------------------------
3dxfB           ----------------------------------------------------------------------
3cq0B           ---------------------------------HEKIENAMDKILVEFGTQILK--VVPGRVSTEVDARL
3bmeC           -------PAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELN--KERSNTAVVQADLTN
3bzuD           ----------------------------------------------------------------------
2b4qB           ----LAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLS----AYGDCQAIPADLSS
1dohA           ----------------------------------------------------------------------
3d3eB           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLEL--GAASAHYIAGTMED
3d4nD           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVS--HCLELGAASAHYIAGTMED
2e6hC           ---------------------------------ILVTNDDGIYSPGLWALAEA--ASQFGEVFVAAPDGH
2e6bD           ---------------------------------ILVTNDDGIYSPG-LWALAEAASQFGEVFVAAPDTHA
1dhrA           ---------------------------------------------------------------TDSFTEQ
2e6cD           ---------------------------------ILVTNDDGIYSPGLWALAEAASQFGEV--FVAAPDTH
2ekpA           ----------------------------------------------------------------------
3ek2B           -----------------------------------------------------------------CDVAD
2e6bC           ---------------------------------ILVTNDDGIYSPG-LWALAEAASQFGEVFVAAPDTHA
3dooA           ----------------------------------------------------------------------
2e6gA           ---------------------------------ILVTNDDGIYSPG----LWALAEAASQFGEVFVAAPD
1d4gA           --------------------------------------------------------------KEGNIFVT
1di7A           ---------------------------------SISDRYQDKGIPALEEWLTSALTTPFEL--ETRLIPD
1dj3A           ---------------------------------VCDLRHMDTFGDKLDVLFEDA---AARFEGFKYSKGM
3c2qA           ---------------------------------LYGTSLGVNIKTAKP-----VTGGHKHHIYAINAIND
3edmA           ----FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAAT--AVAEIEKLGRSALAIKADLTN
2c29F           -------ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKAADEGS
2ekqD           --------------------------------------EALVARGYRVAIASRNPEAQSLGAVPLPTDLE
1ae1B           ----------------------------------------------------------------------
3d5qA           ----------------------------------------------------------------------
2c5aB           ----SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDM----FCDEFHLVDLRVMENCL
2bgkA           ----LQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGS----PDVISFVHCDVTK
2e6eB           ---------------------------------ILVTNDDGIYSPGLWALAE----AASQFGEV-FVAAP
2aqkA           ----------------------------------------------------------------------
2aqhA           --GLLDGKRILVSGIITDSSVAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
1cwuA           --------------------------------------------------------------------SS
2b4qA           ----------------------------------------------------------------------
3d7lA           ---------------------------------------------------------------------T
3ctmD           ----------------------------------------------------------------------
1e3sA           ---SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQA
2c54B           ----SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEH----MTEDMFCDEFHLVDLRVMENCL
3e03A           ----LSGKTLFITGASRGIGLAIALRAARDGANVAIAAKSAVANPKLPGTIHSAAAAVNAAGALKCDIRE
1e6wD           ---SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQA
2aw5A           --------------------------------------------------------------------FA
1e7sA           -----------------------------------------------------------------DSRAV
2b37C           --GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
2eggA           ----------------------------------------------------------------------
2dknB           ---------------------------------VIGIDRGQADIEADLSTP------GGRETAVAAVLDR
2a92C           -----------------------------------------------VMFDVVKNMPQGKALDTSHSNVM
1ae1A           ----------------------------------------------------------------------
2e6eD           ---------------------------------ILVTNDDGIYSPGLWALAEAASQFGEVF-VAAPDIAH
1e7qA           ----------------------------------------------------------------------
3ctmB           ----------------------------------------------------------------------
2c5eB           ----------------------------------------------------------------------
3cxrA           ----------------------------------------------------------------------
2e37D           -----------------------------------LVDLDRKLAQAHAEDILHATPFAHPVWV--RAGSY
3ctmE           -----------------------------------------------------------------CNISD
3c2qB           ------------------------------------------------------------------AIND
2aq8A           ----LDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
2b36B           --GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
3d7lD           ----------------------------------------------------------------------
3bmnD           ----------------------------------------------------------------------
2eghA           ------GKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFS------PRYAVMDD
1e3wA           ---SVKGLVAVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGETEAKKLGGNCIFAPANVTSEKEVQA
2dteA           ---------------------------------------------------------------------N
1bxkA           -------------------------------------TSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEK
1c9kB           -------------------------------------ATSQILDDEMAARIQH---HKDGRPAHWRTAEC
3donA           ----------------------------------------------------------------------
2b35C           --GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
3diiA           -----------------------------------------CFIDIDEKRSADFAKERPNLFYFHGDVAD
2c07A           ----------------------------------------------------------------------
2b35D           --GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
3ctmG           ----LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYG---VHSKAYKCNISD
1e7wA           ----------------------------------------------------------------------
1bdbA           ----------------------------------------------------------------------
3d64A           ----------------------------------------------------------------------
1cbuC           ----------------------------------------------------------------------
2b35B           --GLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
3d4nA           PEM-LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVS--HCLELGAASAHYIAGTMED
3e6vA           ----------------------------------------------------------LTTTSGNLHGQP
1e6wA           ----------------------------------------------------------------------
2c59A           --------------------------------------------------------------LRVMENCL
3cxtA           ------------------------------------------------------------------DVTD
2axqA           --------------------------------------DTLAANDDINVTVACRTLANAQALAKPSGSKA
1a9yA           ----------------------------------------------------------------------
2bf7A           ----------------------------------------------------------------------
3ctmA           ----LKGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKA---YKCNISD
3e9qB           ----LNDRIILVTGASDGIGREAATYARYGATVILLGRNEEKLRQVASHINEETGRQPQWF-ILDLLTCT
2bd0A           ----------------------------------------------------------------------
1e6wB           ----------------------------------------------------------------------
1bdmA           ------------------------------------------------------------------EGVV
3ctmC           ----------------------------------------------------------------------
2c7vD           ----------------------------------------------------------------------
1cydA           ----------------------------------------------------------------------
2bfaA           ----------------------------------------------------------------------
1bsvA           ----------------------------------------------------------------------
3edmC           ----FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGAAT--AVAEIEKLGRSALAIKADLTN
1cg1A           -------------------------------------------------------HNFQLVNYYKAEAVD
2bfpB           ----------------------------------------------------------------------
1e92A           -------------------------------------------------------------------VTL
2c54A           ----SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHM---TEDMFCDEFHLVDLRVMENCLK
2bfmB           ----------------------------------------------------------------------
2bfoA           ----------------------------------------------------------------------
2bfaB           ----------------------------------------------------------------------
2a92B           ------PKPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNV--------MAYSN
2cukA           ------------------------------------------------YPFLSLEELLKEADVVSLHTPL
2c7vA           ----------------------------------------------------------------------
2c7vB           ----------------------------------------------------------------------
3bmnC           ----------------------------------------------------------------------
3edmD           ----FTNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAEGAATAVAEIEKLGRSALA---IKADLTN
2e6gJ           ----------------------------------------------------------------------
3bmqC           ----------------------------------------------------------------------
2b35F           ----LDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
2bf7B           ----------------------------------------------------------------------
2e37C           --------------------------------------------------------------PVWVRAGS
3dijA           -----------------------------------------CFIDIDEKRSADFAKERPNLFYFHGDVAD
1e7wB           ------------------------------------------------------------------PVTL
1buaB           ----------------------------------------------------------------------
3bmqA           ----------------------------------------------------------------------
1d4fA           ATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIEPINALQAAMEGYEVTTMDEA-CKEGNIFVT
1a7aB           --------------------------------------------------------------------VT
1b3rA           --------------------------------------------------------------KEGNIFVT
1cg3A           ---------------------------------------------------------VNYYKAEAVDYQK
3bmoD           ----------------------------------------------------------------------
3bmfB           ----------------------------------------------------------------------
2c59B           ----------------------------------------------------------------------
2c82A           --------------------------------------------------------------VTNIAVAD
3bmiB           ----------------------------------------------------------------------
3bmkC           ----------------------------------------------------------------------
1e92B           ----------------------------------------------------------------------
3bmeB           ----------------------------------------------------------------------
2e37B           -----------------------------------------------------------------RAGSY
2e37A           ------------------------------------------------------------------RAGS
3bmdB           ----------------------------------------------------------------------
1c9kA           ----------------------------------------------------------------------
1e6wC           ----------------------------------------------------------------------
1di6A           -------------------------------------------------------------------IPD
3dtdB           --------------------------------------------------------------MHRQEVND
1a7aA           ---------------------------------------------------------------EGNIFVT
1bdmB           ----------------------------------------------------------------------
3bzuC           ----------------------------------------------------------------------
3d7lB           ----------------------------------------------------------------------
3bmfC           ----------------------------------------------------------------------
2bfaD           ------------------------------------------------------------------PVTL
3d7lF           ----------------------------------------------------------------------
2e37E           ---------------------------------VVLVDLDRKLAQAHAEDILHA---TPFAHPVWVRAGS
1ek5A           ----------------------------------------------------------------------
3bmfA           ----------------------------------------------------------------------
3dhnA           ----------------------------------------------------------------------
3bmoA           ----------------------------------------------------------------------
3bmnB           ----------------------------------------------------------------------
3bmoC           ----------------------------------------------------------------------
1adeA           ---------------------------------VGDLFDKETFAEKLKEVMEYH--NFQLVNYYKAEAVD
2c7vC           ----------------------------------------------------------------------
3bmjD           ----------------------------------------------------------------------
3bmfD           ----------------------------------------------------------------------
2b37B           ----LDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
1d0iA           --------------------------------NLNLLGQRQPEIYGSDTLADVEALCVKAAAAGTVDFRQ
2bfaC           ----------------------------------------------------------------------
2eezA           ------------------------------------------------------------------LTAT
3dbhC           ------------------------------------------------------------------SSIG
2bf7D           ----------------------------------------------------------------------
3d3jA           ----------------------------------------LANHDVQVILFLPNFVKMLESITNELSLFS
1e92D           ----------------------------------------------------------------------
1a4uA           ----------------------------------------------------------------------
1a4iB           -----------------------------------------------------------------TGQPE
2a92A           ------------------------------------------------QGKALDTSHSNVMAYSNCKVTG
3bmeA           ----------------------------------------------------------------------
2e6gB           -------------------------------------GIYSPGLWALAEAAS----QFGEVFVAAPIAHP
2c5eA           ----SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRV----MENCL
1cg4A           ----------------------------------------------------------------------
2c5aA           ----SENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLV-----DLRVMENC
2bfoC           ----------------------------------------------------------------------
2bfmC           ----------------------------------------------------------------------
3dfzB           VMLDLKGRSVLVVGGGTIATRRIKGFLQEGAAITVVAPTVSAEINEWEAKGQLRVKRKKVGEEDLLNVFF
1bwsA           ----------------------------------------------------------------------
3bmnA           ----------------------------------------------------------------------
1a4iA           ----IAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIK
2e6gG           ---------------------------------ILVTNDDGIYSPGLWALAEAASQFGEVFVAAPDTITI
3e9nA           ----------------------------------------------------------------------
1e92C           ------------------------------------------------------------------PVTL
2bfpD           ----------------------------------------------------------------------
2ef0A           -----------------------------------------------------------------EAALG
1edzA           -----------------------------------------------SVDVNNIQKFTRGESLKLNKHHV
2bf7C           ----------------------------------------------------------------------
3e9nC           ----------------------------------------------------------------------
3e9nB           ----------------------------------------------------------------------
1civA           TKSWKKIINVAVSGAAGMISNHLLFKLASGEVFGPDQPISLKLLGSERSFAALEGVAMEL----EDSLYP
3e9nD           ----------------------------------------------------------------------
1e6uA           ----------------------------------------------------------------------
3dqpA           ----------------------------------------------------------------------
1b0aA           --------------------------------------RFTKNLRHHVENADLLIVAVGKPGFIPGDWIK
2c20A           ----------------------------------------------------------------------
2bkaA           ----------------------------------------------------------------------
2a35A           ----------------------------------------------------------------------
3dtdA           ----------------------------------------------------------------------
3e9nE           ----------------------------------------------------------------------
1bw3A           ---ATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGP---RGQAACGKCLRVTN
3e8xA           ----------------------------------------------------------------------
1ddtA           ----------------------------------------------------------------------
3e9nH           ----------------------------------------------------------------------
2e6gF           ---------------------------------ILVTNDDGIYSPG-LWALAEAASQFGEVFVAAPDTTI
3ejxD           ----------------------------------------------------------------------
2dt8A           ---------------------------------VNLSGAIYRDWEEITPTEIFQKVREGAA-FPTTSQPS
3dxfA           ----------------------------------------------------------------------
3e9nF           ----------------------------------------------------------------------
3c3xA           --------------------------------------------------------------FQSLGAII
3bywC           ---------------------------------LQITSHGELVLDLSKRELAQLPADATI---AISATED
1b93A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLTGTFICTQAALPAMLEAGWGR
1a27A           RDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1dohB           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRL-
3ce6B           ATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGR
2ae1A           RSERQELMNTVANHFHGKNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGN
3ch6E           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-
1a9zA           NEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGD
1dj2A           PEMLREEVEAYKRYADRLEPYITDTV-----HFINDSISQKKKVLVEGGQATMLDIDFGTYPFVTSSSPS
3d3eA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GS
3deyX           SKSVAAARERVTEGR--VDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
2d1yB           ERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
2belC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-
3ce6A           ATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGR
2cnbB           DVRNEDFLNGVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAA
3bzuB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
3d5qC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GS
2d1yA           ERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
3czrA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GS
3dwfB           MTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSI
2aw5C           HEHEEMKNLEAIVQEIKPTALIGVAAIGGAQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRA
3dwfA           MTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMP-MLMQSQGS
3dwfC           MTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMP-MLMQSQGS
3d3wA           DLGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPG
2a4kA           PKAVEAVFAEALEEFGRLHGVAHFAG----VAHSALPLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLV
2belA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
2e6hD           HAITI---------AHPVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLHE
3ce6D           ATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSIIVLSEGR
3bmoB           SNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL
2aw5B           HEHEEMKNLEAIVQEIKPTALIGVAAIGGAQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRA
3ch6B           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
3d5qD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GS
1bmdA           LAGLEATDDPDVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPAN
3e9qA           SENCQQLAQRIVVNYPRLDGVLHNAGLLGDVCPSEQNPQVWQDV--QINVNATFLTQALLPLLLKSDAGS
3ctmF           PKSVEETISQQEKDFGTIDVFVANAG-------VTWTQGPENKIISVDLNGVYYCSHNIGKIFKKNGKGS
2belB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GS
2d1yC           ERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
3bhmA           LQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKP--QGR
3csdB           VPEIEALVAAVVERYGPVDVLVNNAGRLGGGATAELADELWLDVVETNLTGVFRVTKQVLKAGGMLERGT
2aqiA           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIPGG
3ch6D           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGS
2ag5A           KKQIDQFANEV----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
2b35A           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYASMAKALLPIMNPGG
1c9yA           NGTKLLLTNDPLEAAHGGNVLITDTWISMGREEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRKPE
2e6gK           FGEVFVAAPDTITIAHPVRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGHE--
2e6cC           SAAGH-----AITIAHPVRAYPHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGSNLGH
2belD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSN-GS
1dfiA           DASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYAMAKACRSMLNPGSA
3ek2A           DAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALALPMLSDDAS
3ctmH           PKSVEETISQQEKDFGTIDVFVANAGVTWTQGP-------EIKIISVDLNGVYYCSHNIGKIFKKNGKGS
2b35E           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIPGG
2cnbC           DVRNEDFLNGVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAA
1c3vA           THPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARF
2ehdB           EGDWARAVAAMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGT
2e6hB           FGEVFVAAPDHAITIHPVRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGS--NLGHE
2d1yD           ERERVRFVEEAAYALGRVDVLVNNAAIAAPGSALTVRLPEWRRVLEVNLTAPMHLSALAAREMRKVGGGA
3d5qB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
1edoA           ---------------------VNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATKIMMKKRKGR
3e03C           EDQVRAAVAATVDTFGGIDILVNNASAIW--LRGTLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPH
3e03B           EDQVRAAVAATVDTFGGIDILVNNASAIW--LRGTLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPH
2ehdA           EGDWARAVAAMEEAFGELSALVNNAGVGVMKPVHELTLEEWRLVLDTNLTGAFLGIRHAVPALLRRGGGT
3ek2D           DAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPKAALPMLSDDAS
2cfcA           VNAAIAATMEQFGAIDVLVNNAGITGNSEAGVLHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGV
1c14A           DASIDTMFAELGKVWPKFDGFVHSIGQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSML--NPGSA
1bxkB           VDICDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAF
2dfdA           ----------------------GCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICV
1d7oA           NWTVQEAAECVRQDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSSFVSLLSHFLPIMNPGGAS
3byzA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGS
2a4kB           PKAVEAVFAEALEEFGRLHGVAHFAGVA------------WEKVLRVNLTGSFLVARKAGEVLEEGG---
2dknA           DGLVCCAGVGVTAANSGLVVAVNGVSALLDGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEA-MLAG
3c6cA           -------------------------------------------------------ELGIKPELEVFSPGD
3d3uA           HTEMFTDGVMRMIRKGIINGKKKTLHPEKVVTSLIFGSKELYDFVNNNPVIECYPVDYINNPDVIGDRMV
2cnbA           EDFLNGVFTRHGPIDAVVHMCAFLAVGESVRDPLKYYDNNVVGILRLLQAMLLHKCDKIIFSSSAAIFGN
1ahhA           EQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPM-ADFRRAYELNVFSFFHLSQLVAPEMEKNGGGV
3d4nB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGS-
3d4nC           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
3ek2C           DAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALALPMLSDDAS
2ag5B           KKQIDQFAN----EVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
3edmB           AAEVEAAISAAADKFGEIHGLVHVAGGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAI
3ch6A           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
3bzuA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGS
3e48A           QESVEAFKGDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFIGYYADQHNNPFHSPYFGYASRLL
2ag5C           KKQIDQFAN----EVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
1b8pA           LLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNAN
3dfzA           -----------------------MDGNIQIPAQFSRGRLSLAISTDGASPLLTKRIKEDLSSNYDESYTQ
2ae2A           --------------------------------AKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGN
1bhsA           RDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
3dxfB           ----------------------DLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVEEYFRDIGVP
3cq0B           SFDKKATVKKALHIIKYKDAGVPKERVLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEAN
3bmeC           SNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNL
3bzuD           ---------------------ILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
2b4qB           EAGARRLAQALGELSARLDILVNNAG----TSPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAENPAR
1dohA           -----------------------NSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLI
3d3eB           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
3d4nD           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSI
2e6hC           AITIAHPVRAY----PHPSPLHAPHFPAYRVRGTPADCVALGLHLFGPVDLVLS------GVNLGSNLGH
2e6bD           ITIA--HPVRAYPHPSPLHAPHFPAYRV---RGTPADCVALGLHLFGPVDLVLSGVNLGSNL-----GHE
1dhrA           ADQVTAEVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEG--GL
2e6cD           AITIAHPVR-AYPHPSPLHAPHFPAYRV---RGTPADCVALGLHLFGPVDLVLSGVNLGSNL-----GHE
2ekpA           ----------ALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEAGWVL
3ek2B           DAQIDALFASLKTHWDSLDGLVHSIGFAPREAIAGDFLDGLTRENFRIAHDISAYSFPALALPMLSDDAS
2e6bC           ITIA--HPVRAYPHPSPLHAPHFPAYRV---RGTPADCVALGLHLFGPVDLVLSGVN-----LGSNLGHE
3dooA           ----------------------------------------RLASHTLVSDIVYNPYKTPILIEAEQRGNP
2e6gA           AHP---VRAYPHPSPAPHFPAYRVRGTPADCVALGLH---LFGPVDLVLSGVNLGSNL---------GHE
1d4gA           TTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGRRIILLAEGRL
1di7A           EQAIIEQTLCELVDEMSCHLVLTT--GGTGPARRDVTPDATLAVADREMPGFGEQMRQVPTAILSRQVGV
1dj3A           LKEE--------VERYKKFAERLEPFIADTVHVLNESIRQKKKILVEGGQATMLDIDFGTYPFVTSSSPS
3c2qA           AGNIKNAVESGVLKEGIYQCIKNNIPYVLAGSIRDDG---PIPDVITDSVAQDKRTTVDKKVILSTLLHS
3edmA           AAEVEAAISAAADKFGEIHGLVHVAGGLARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIV
2c29F           FDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLP
2ekqD           KDDPKGLVKRALEALGGLHVLVHAAAVNVRKPALELSYEEWRRVLYLHLDVAFLLAQAAAPHMAEWGRVL
1ae1B           ----------------------------------------YNIIMGTNFEAAYHLSQIAYPLLKASQNGN
3d5qA           ----------------------------------------VRKSMEVNFLSYVVLTVAALPMLKQSNGSI
2c5aB           KVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQL-ET
2bgkA           DEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGS
2e6eB           DTTIAHPVRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLAAAKQG----YLFGLSAAA
2aqkA           ----------------------------------------YADVSKGIHISAYSYASMAKALLPIMNPGG
2aqhA           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADKGIHISAYSYASMAKALLPIMNPGG
1cwuA           NWTVQEAAECVRQDFGSIDILVHSLGNGPEVSKPLLETSRKGYLAAISASSSFVSLLSHFLPIMNPGGAS
2b4qA           ---------------------VNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAV
3d7lA           VDITNIDSIKKYEQVGKVDAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSL--NDKGS
3ctmD           ----------------------------------------IDKIISVDLNGVYYCSHNIGKIFKKNGKGS
1e3sA           ALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQ
2c54B           KVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQL-ET
3e03A           EDQVRAAVAATVDTFGGIDILVNNASAIW--LRGTLDTPKRFDLQQVNARGSFVCAQACLPHLLQAPNPH
1e6wD           ALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQ
2aw5A           HEHEEMKNLEAIVQEIKPTALIGVAGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRA
1e7sA           HDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQ
2b37C           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIPGG
2eggA           ----------------------------------------RLRPGVIVSDIIYNPLETKWLKEAKARGAR
2dknB           CGGVLDGLVCCAGVNSGLVVAVNYFGVSALGLAEALSRGQQPAAVIVGSIAATQPGAAELPMVEAMLAGD
2a92C           AYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIVD
1ae1A           --------------------------------AKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGN
2e6eD           PVRAYPHPPHFPAYRVPADCVALGLHLFGPVDLVLSGVNLVAAAKQGYLFGLSAAAFSVPEVPLERPFLV
1e7qA           ----------------------VANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGASCIYPKLAKQ
3ctmB           ----------------------------------------IDKIISVDLNGVYYCSHNIGKIFKKNGKGS
2c5eB           --------------------FIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPE-FKQLET
3cxrA           --------------------------------MIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGK
2e37D           GDLEGARAVVLAAGVARLQLLDRNAQVFAQVVPRVLEAALLVATNPVDVTQVAYRLSGLPP-GRVVGSGT
3ctmE           PKSVEETISQQEKDFGTIDVFVANAG-----VTWTDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGS
3c2qB           AGNIKNAVESGVLKEGIYQCIKNNIPYVLAGSIRDDG---PIPDVITDSVAQDKRTTVDKKVILSTLL--
2aq8A           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINFDAPYADVSKGIHISAYSYASMAKALLPIMNPGG
2b36B           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIPGG
3d7lD           --------------------IVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLNDKGSFT
3bmnD           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKGSSNLS
2eghA           EASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANK-ES
1e3wA           ALTLAKEKFGRIDVAVNCAGIAVAIKTYHEKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQ
2dteA           PDQVKASIDHIFKEYGSISVLVNNAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPS
1bxkA           VDICDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDKKSAF
1c9kB           WRHLDTLITADLAPDDAILL-ECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAK
3donA           ------------INLSHAESHLDEFDIIINTTPDSVISLNRLASHTLVSDIVYNPYKTPILIEAEQRGNP
2b35C           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKLPIMNPGG
3diiA           PLTLKKFVEYAMEKLQRIDVLVNNACG-SKGILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKG-R
2c07A           ----------------------------------------WEDVLRTNLNSLFYITQPISKRMINNRYGR
2b35D           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADKGIHISAYSYASMAKALLPIMNPGG
3ctmG           PKSVEETISQQEKDFGTIDVFVANAGV----TWTVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKGS
1e7wA           -------------------------------LLREAMETATADLFGSNAIAPYFLIKAFAHRVAGGTNYS
1bdbA           ----------------------------------------FDEVFHINVKGYIHAVKACLPALVASRGNV
3d64A           ----------------------------------------RQYQWENIKPQVDHIIFPDGKRVILLAEGR
1cbuC           ----------------------------------------PEQWDYAAMERAIDDEIQILIAACQRCPAK
2b35B           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMGG
3d4nA           MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPML-KQSNGS
3e6vA           VSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVNPGEHMTEVDRLGIGKVMEETLSYLLGRKKRP
1e6wA           ----------------------------------------FQRVINVNLIGTFNVIRLVAGVMGQNEPDQ
2c59A           KVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLET-
3cxtA           EDGIQAMVAQIESEVGIIDILVNNAGIIRRVPMIEMTAAQFRQVIDIDLNAPFIVSKAVIPSMIKKGHGK
2axqA           ISLDVTDDSALDKVLADNDVVISLIPYTFHPNVVKSAIRTKTDV--VTSSYISPALRELEPEIVK---AG
1a9yA           ----------------------------------------VNGTLRLISAMRAANVKNFIFSSAATVYGD
2bf7A           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRKHRGTNYS
3ctmA           PKSVEETISQQEKDFGTIDVFVANAGVTWTQEIDVDNYDSWNKIISVDLNGVYYCSHNIGKIFKKNGKG-
3e9qB           SENCQQLAQRIVVNYPRLDGVLHNAGLLGDVCPSEQNPQVWQDV--QINVNATFLTQALLPLLLKSDAGS
2bd0A           ----------------------------------------FDYTMNTNLKGTFFLTQALFALMERQHSGH
1e6wB           ----------------------------------------FQRVINVNLIGTFNVIRLVAGVMGQNEPDQ
1bdmA           MELEDCAFPLLAGLEATDDPDVAFKDADYALLVGAAPLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPAN
3ctmC           ----------------------------------------WNKIISVDLNGVYYCSHNIGKIFKKNGKGS
2c7vD           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKGSSNLS
1cydA           ----------------------------------------FDRSFSVNLRSVFQVSQMVARDMINRGVPG
2bfaA           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGTTNYS
1bsvA           ---------------AAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQ
3edmC           AAEVEAAISAAADKFGEIHGLVHVAGLIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKGGAIV
1cg1A           YQKVLDDTMAVADILTS---MVVDVSDLLDQARQR-----GDFVMFEGAQGTLLDIDHGTYPYVTSSNTT
2bfpB           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGTTNYS
1e92A           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRAMETATADLFGSNAIAPYFLIKAFAHRKHRGTNYS
2c54A           VTEGVDHVFNLAAD-MGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPE-FKQLET
2bfmB           ----------------------NNASSFYPTPLLRNMETATADLFGSNAIAPYFLIKAFAHRKHRGTNYS
2bfoA           ---------------------VNNASSFYPTPLLRGDREAMETATASNAIAPYFLIKAFAHRKHRGTNYS
2bfaB           ------------------------------------METATADLFGSNAIAPYFLIKAFAHRVAGGTNYS
2a92B           CKVTGSNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNP
2cukA           TPETHRLLNRERLFAMKRGAILLNTARGALVDTEALVEALRGHLF-----GAGLDVTDPEPLPPGHPLYA
2c7vA           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKGSSNLS
2c7vB           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKTSSNLS
3bmnC           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKSSNL-S
3edmD           AAEVEAAISAAADKFGEIHGLVHVAGGIARKTIAEMDEAFWHQVLDVNLTSLFLTAKTALPKMAKG-GAI
2e6gJ           -----GEVFVAAPDAHPVRAYPHPSPPHFPAYRVRGTPADCVALGLHLFGPVDLVLSGVNLGS--NLGHE
3bmqC           -----------------------NASAFYPTPLVQGGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLS
2b35F           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMGG
2bf7B           -------------------------------LLREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPNYS
2e37C           YGDLEGARAAQRPGETRLQLLDRNAQVFAQVVPRVLEAAPEAVLLATNPVDVTQVAYRLSGLPPGRVVGS
3dijA           PLTLKKFVEYAMEKLQRIDVLVNNACGSKG-ILSSLLYEEFDYILSVGLKAPYELSRLCRDELIKNKGRI
1e7wB           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRGDREAMETATASNAIAPYFLIKAFAHRKHRGTNYS
1buaB           --------------------------------------DLINALYDEDVCGISAEGKIYPLGSDTKVLST
3bmqA           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKGSSNLS
1d4fA           TTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLAEG-R
1a7aB           TTGCIDIILGRHFEQKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLV
1b3rA           TTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLAEG-R
1cg3A           VLDDTMAVADILTSMVVDVSDLLDQARQR-----------GDFVMFEGAQGTLLDIDHGTYPYVTSSNTT
3bmoD           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKGSNLSI
3bmfB           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQ----NLS
2c59B           -----------------------SNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLET-
2c82A           EHAAQRVGDIPYHGSDAATRLVEQTEADVVLNALVGALGLRPTLAALKTGARLALANKESLVAGGSLVLR
3bmiB           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQSSNLS--
3bmkC           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQ---KNLS
1e92B           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGTPAKS
3bmeB           -------------------------------PLVKTVETQVAELIGTNAIAPFLLTMSFAQRQ----NLS
2e37B           GDLEGARAVVLAAGVARLQLLDRNAQVFAQVVPRVLEAAPEAVLLATNPVDVTQVAYRLSGLPPGRVVGS
2e37A           YGDLEGARAAQRPGETRLQLLDRNAQFAQVVPRVLEAAPEAVLLVATNPVDVTQVAYRLSGLPPGRVVGS
3bmdB           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQ----NLS
1c9kA           ----------------------------------------PEQWDYAAMERAIDDEIQILIAACQRCPAK
1e6wC           --------------------------------NQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPDQ
1di6A           EQAIIEQTLCELVDEMSCHLVLTTGGTGP--ARRDVTPDATLAVADREMPGFGEQMRQISLHF---VPTA
3dtdB           QNRVVVAMSVVLNADGVVSGNLSKPVRLQVDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAAL-RAGKHL
1a7aA           TTGCIDIILGRHFEQKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGHPS
1bdmB           ----------------------------------------RRDLLQVNGKIFTEQGRALAEVAKKDVKVL
3bzuC           ----------------------------------------VRKSMEVNFLSYVVLTVAALPMLKQSNGSI
3d7lB           ------------EQVGKVDAIVSATGSATFSPLTELTPEKNAVTISSKLGGQINLVLLGIDSLND--KGS
3bmfC           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQ----NLS
2bfaD           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRDREAMTADLFGSNAIAPYFLIKAFAHRVAGTTNYS
3d7lF           ----------------------------------------NAVTISSKLGGQINLVLLGIDSLND--KGS
2e37E           YGDLEGARAAQRPGETRLQLLDRNAQVFAQVVPRVLEAAPEAVLLATNPVDVTQVAYRLSGLPPGRGSGT
1ek5A           ----------------------------------------LTGTIQLLEIMKAHGVKNLVFSSSATVYGN
3bmfA           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQS---NLS
3dhnA           ---------------------EVCEVCKGADAVISAFNPIYDETIKVYLTIIDGVKKAGVNRFLVGGAGS
3bmoA           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKGTTSSN
3bmnB           ----------------------------------------TQVAELIGTNAIAPFLLTMSFAQRQKSNLS
3bmoC           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQKSSNLS-
1adeA           YQKVLDAVADILTSMVVDVSDLLDQARQR-----------GDFVMFEGAQGTLLDIDHGTYPYVTSSNTT
2c7vC           ----------------------------------------TNAIAPFLLTMSFAQRQKGTNPNCTSSNLS
3bmjD           -------------------------SAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQ----SNL
3bmfD           ----------------------------PTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQ----SNL
2b37B           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDVSKGIHISAYSYASMAKALLPIMNPGGSIV
1d0iA           SNHEGELVDWIHEARLNHCGIVINPAHTSVAILDALNTCDGLPVVEVHISNIH---------QREPFRHH
2bfaC           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGGTNYS
2eezA           EANIKKSVQHADLLIGAVLKLVTRDM------LSLMKEGAVIVDVAYVVDGVVHYGVANMPGAVPRTSTF
3dbhC           KNRAEAAMEFLQELNSDVSGSFVEESPE----NLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQI
2bf7D           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGGTNYS
3d3jA           KTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQPW--YKAAVAWANQNRAPVLSIDPPVHIDAKWSL
1e92D           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGTPNYS
1a4uA           ----------------------------------------TIAINFTGLVNTTTAILDFWDKRKGGPGGI
1a4iB           MVKGEWIKPGAIVIDCGINYVPDDKKPNG-----------RKVVGDVAYDEAKERASFITPVP----GGV
2a92A           SNSYD-----DLKGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNP
3bmeA           -------------------------------LVGKTVETQVAELIGTNAIAPFLLTMSFAQRQ----SNL
2e6gB           VRAYPHPSP----LHAPHFPAYRVRGTPADCVALGLH---LFGPVDLVLSGVNLGSNL---------GHE
2c5eA           KVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPE-FKQLET
1cg4A           ------AVADILTSMVVDVSDLLDQARQR-----------GDFVMFEGAQGTLLDIDHGTYPYVTSSNTT
2c5aA           LKVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLET
2bfoC           ------------------------------------DLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYS
2bfmC           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGTTNYS
3dfzB           IVVATNDQAVNKFVKIKNDQLVNMASSFSDGNIQIPSRGRLSLAISTDGASPLLTKRIKLSSNYDESYTQ
1bwsA           ----------------------------------------SNIIHAAHQNDVNKLLFLGSSCIYPKLAKQ
3bmnA           ----------------------------------------VAELIGTNAIAPFLLTMSFAQRQSSNLSIV
1a4iA           PGAIVIDCGINYKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRF--------------
2e6gG           AHPVRAYPHPS-PLHAPHFPAYRVRGTPADCVALGLH---LFGPVDLVLSG----------VNLGSNLGH
3e9nA           ----------------------------------------WHAHLDLNVIVPAELSRQLLPALRAASGCV
1e92C           FTRCAELVAACYTHWGRCDVLVNNASSFYPTPDREAMETATADLFGSNAIAPYFLIKAFAHRVAGGTNYS
2bfpD           ----------------------------------------TADLFGSNAIAPYFLIKAFAHRVAGTPNYS
2ef0A           AHALYTDVWTEKRLRDFQGFQVNGELLKLLRPGEETTEEAVHGPRSRVFDQAENRAKAVLLTLLK-----
1edzA           EDLGEYSEDLLKKCSLDSDVVITGVPSENYKFPTEYIKE-GAVCINFACTKNFSDDVKEKA-------SL
2bf7C           -----------------------NASSFYPTPLLEAMETATADLFGSNAIAPYFLIKAFAHRVAGGTNYS
3e9nC           ----------------------------------------WHAHLDLNVIVPAELSRQLLPAL-------
3e9nB           -------------------------------LVHAASVAEWHAHLDLNVIVPAELSRQLLPALRAASGCV
1civA           LLRQVSIGIDPYEIFQDAEWALLIGAKPRGPGMERADLLDINGQIFAEQGKLNAVASPNVKVMVVGNPCN
3e9nD           ----------------------------------------------------------------------
1e6uA           ----------------------VANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQ
3dqpA           ----------------------------------------SGSGGKSLLKVDLYGAVKLQAAEKAEVKRF
1b0aA           EGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPM--TVATLIENTLQACVEYHDP-----
2c20A           -------------------------------------------------------------------TYG
2bkaA           ----------------------------------------GKAGAEGFVRVDRDYVLKSAELAKAGGCKH
2a35A           ----------------------------------------EAGSEEAFRAVDFDLPLAVGKRALEMGARH
3dtdA           --------------------ILVSKPVRLQDEGKAVIETGIRTCVPAGCIVPIVFDKNYVAAL-RAGKHL
3e9nE           ----------------------------------------------------------------------
1bw3A           PATGAQITARIVDQCGGLDLDWDTVFT----KIDTNGIGYQQGHLNVNYQFVD-----------------
3e8xA           ----------------------------------------------------------------------
1ddtA           ----------------------------------------MSESPNKTVSEEKAKQYLEEFHQTALEHPE
3e9nH           ----------------------------------------------------------------------
2e6gF           AHPVRAYPHP-----SPLAPHFPAYRVRG--TPADCVALGLHLFGPVDLVLSGV--------NLGSNLGH
3ejxD           --------------------LVDNRDSSEPKI----TQEQAAKLCDRNFGVGADGVIFAMPGVNGTDYAR
2dt8A           PEDFARVYREALEEADHVLSLHISGKLSGTQSAELAAQEFPGRVVDTQAASLGVGVLRAKELLLEAVLAE
3dxfA           ----------------------------------------------------------------------
3e9nF           ----------------------------------------------------------------------
3c3xA           VKGELDEHEKLVELMKKVDVVISALAVPQYLDQFKILEAIKVAGNIKR-------------------FLP
3bywC           ETTAGIEGDTVERDVRPIIGIYTELE-----SNAAADLLNAGLNAHVEINSRF-----------------
1b93A           ---------------GKIDVLIFFWDPLNAVPHDPDVKALLRLATVIPVATNVATADFIIQSPHFNDAVD


                         +         .         .         .         .         *         .:210
query           IVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALELATKGVTVNAVCPGYTETDIVRDAVANIVGKTGR
1a27A           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDR
1dohB           ILMGSITGQAKAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNGEN
3ce6B           LLNLGNATGHPQIELWTKNDEYDNEVYRLPKHLDEKVARIHVEALGGHLTKLTKEQAE------------
2ae1A           VVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATQDPEQ-----------
3ch6E           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
1a9zA           NPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDM---------GE
1dj2A           AGGICTGLGIAPSVVGDLIGVVKAYTTRVGSGPFPTTGGDLLRLAGQEFGTTTGRPRRCGWLD-IVALKF
3d3eA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTETAMKAVSGIVQAA--
3deyX           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTGSPEEVLDRTDIHTFH
2d1yB           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLE-----------
2belC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTETAMKA-------VSG
3ce6A           LLNLGNATGHPSIELWTKNDEYDNEVYRLPKHLDEKVA----RIHVEALGGHLTKLTKEQAE--------
2cnbB           IFGNPTAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLRYFNACGAHED----GDIGEHYQ
3bzuB           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDTETAMKAVSGIVHMQAA
3d5qC           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSRVNVSITLCVLGLIDTETAMKAV---------
2d1yA           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLE-----------
3czrA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDTETAMKAVSGVHMQAAP
3dwfB           A-VVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTETAIKATSGIYLGPAS
2aw5C           IFASGSPFDPVTLPNGQTLACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNT--------IRDV
3dwfA           IAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTETAIKATSGIYLGPAS
3dwfC           IAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTETAIKATSGIYLGPAS
3d3wA           AIVNVSSQSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQAT---------W
2a4kA           LTGSVAGLGAFGLAHYAAGKLGVVGL---ARTLALELARKGVRVNVLLPGLIQTPM-----------TAG
2belA           VVVSSL-AGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
2e6hD           IWHSGTVAAAKQGYLFGLSAAAFSVPLGEVPDFALETLLRNVNLPLRPKGFLWTRQSVRAYEGVV-----
3ce6D           LLNLGNATGHPSIELWTKNDEYDNEVYRLPKHLDEK----VARIHVEALGGHLTKLTKEQAEYLGVDVEP
3bmoB           SIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
2aw5B           IFASGSPFDPVTLPNGQTLYPGQGNNSYVF-------PGVALGVVACGLRQITDNIFLTTAEVI--AQQV
3ch6B           VVVSSL-AGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSNVSITLCVLGLIDTETAMKAVSGIVHMQAA
3d5qD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEVSRVNVSITLCVLGLIDTETAMKAVSMQ------
1bmdA           TNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDL---------
3e9qA           LVFTSSSVGRQGRANWGAYAASKFATEGQVLA---DEYQQRLRVNCINPGGTRTARASA-----------
3ctmF           LIITSSISGKIVNIPQQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITD-----------F
2belB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMKAVSGIVHMQAA
2d1yC           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIATEAVLE-----AIALSP
3bhmA           VVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTVRTDMAG
3csdB           IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASV--------RE
2aqiA           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAG
3ch6D           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNITLCVLGLIDTETAMKAVSGIVHMQAA
2ag5A           IINMSSVASSVKGVVNRVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQA-----RG
2b35A           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGAQIQL----------
1c9yA           EVDDEV----FYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKP-----------------------
2e6gK           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLFLVNVNLPLRPKGFLWTRQSVRAYEGVVIPGED
2e6cC           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLFLVNVNLPLRPKGFLWTRQSVRAYEGVV-----
2belD           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
1dfiA           LLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLMLAHCEAVT------
3ek2A           LLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPISGIKSFGKILDFVES---
3ctmH           LIITSSIGKIVNIPQLQAPYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDITD-----------F
2b35E           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTAGAQI-----------
2cnbC           IFGNPTAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGIKGICLRYFNA------------------
1c3vA           FDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVA
2ehdB           IVNVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLREANVRVVNVLPGSVKLKP--------------
2e6hB           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLRPVNVNLPLRPKGFLWTRQSVRAYEG-------
2d1yD           IVNVASVQGLFAEQENAAYNASKGGLVNLTRSLALDLAPLRIRVNAVAPGAIAT------------EAVL
3d5qB           VVVS-SLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
1edoA           IINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDMTA-----------K
3e03C           ILTLAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATDAIN-----------
3e03B           ILTLAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIATDAIN-----------
2ehdA           IVNVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLREANVRVVNVLPGLKPEDVAQAV--------LF
3ek2D           LLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKSF---------------
2cfcA           IVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRLDQP------
1c14A           LLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGI---------K
1bxkB           RFHHISTDEVDLHSTDDFFTETTASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNA
2dfdA           IANPVNSTIPITAEVFKKHGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTI----------IPL
1d7oA           ISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKQNIRVTISAGPLGSRAAKAI---------G
3byzA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
2a4kB           ----------------SLVLTGKLGVVGLARTLALELARKGVRVNVLLPGLIQAWEQE------------
2dknA           DEARAIELAEQQGQTHLAYAGSKYAVTCLARRNVVDWAGRGVRLNVVAPGAVETPLLQAS--------KA
3c6cA           ILFGIEEGLIDGVPLFQVLGVLWGAPASTETIYQRNLIPANAQWAAFGIGRDQPAQAALLGGN-------
3d3uA           SINSCLEMDLMGQAGQVDFLRGAKRSKGGISIMAFPSTAKKGTESRIVPILKTGRNEVDYVVTE------
2cnbA           PTNAEPIDINAKKSPESPYGESKLIAERMIRDCAEAYGI---KGICLRYFNACGAHEDGDI---------
1ahhA           ILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDAL----------KSV
3d4nB           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
3d4nC           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKA------VSGI
3ek2C           LLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKTSF--------------
2ag5B           INMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE-----RIQARG
3edmB           VTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGMISTT----------------
3ch6A           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
3bzuA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
3e48A           STSGIDYTYVRAYDPLKPYLPELNHKLIYPAGDGRINYITRNDIARGVIAIIKNPDTWGKR--YLLSGYS
2ag5C           INMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQA-----RG
1b8pA           TNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSP---------------
3dfzA           YTQFLYECRVLIHRLNVSKSRKHELLTEIIDDYRLSLVKQREFLQQI-----------------------
2ae2A           VVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTI------QDP
1bhsA           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDR
3dxfB           MTSVRLPCYFENLLSHFLPQKAPDGKSYLLSLPTGDVPMDGMSVSDLGPVVLSLL---------------
3cq0B           VTLISPFVGRIMDFYKAYTAETDPGVLSVKKIYS-YYKRHGYATEVMAASFRNLDELKALAGID--NMTL
3bmeC           SIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP---------------
3bzuD           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVHMQAA
2b4qB           VINIGSVAGISAMGEQAYYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTR---------HIA
1dohA           LMGSITGQA-KAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNGEN
3d3eB           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIVQAA--
3d4nD           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSGIHMQAAP
2e6hC           EIWHSTVAAAKQGYLFGLSAAAFSVPLGEVPDFALETLLRNVNLPLRPKGFLWTRQSVRAYEG-------
2e6bD           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLFLVNVNLPLRPKGFLWTRQSVRAYEGVVIPGED
1dhrA           LTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKGMPSGAAAIAVLPVTLDTPMNRKSMPEA------
2e6cD           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLFLVNVNLPLRPKGFLWTRQSVRAYEG-------
2ekpA           FIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETEFTLPL---------R
3ek2B           LLTLSYLGAERAIPNYNTMGLAKAALEASVRYLAVSLGAKGVRVNAISAGPIKFGKILDFVES-------
2e6bC           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFAGLFLVNVNLPLRPKGFLWTRQSVRAYEGVVIPGED
3dooA           IYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLK--------------------------------
2e6gA           IWHSGTVAAAKQGYLFGLSAAAFSVPGEVPDFAGLRPFLVNVNLPLRPKGFLWTRQSVRAYEGVVIP-GE
1d4gA           VNNSFTNQVMAQIELWTHPDKYPVGVHFLPK----KLDEAVAEAHLGKLNVKLTKLTEKQAQ--------
1di7A           IRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVETAPEV------------
1dj3A           AGGICTGLGIAPRVIGDLIGVVKAYTTRVGSGPFPTEGDVLRKAGMEFGTTTGRPRRCGWLDIV--ALKY
3c2qA           VATGNL------------PSYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG------------------
3edmA           T-FSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVG-PKIRVNAVCPGMISTRE--------------
2c29F           VYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAWKYAKENNIDFITIIPTLVVGPFIM------------
2ekqD           FIGSVTTFTAGGPVPIPAYTTAKTALLGLTRALAKEWARLGIRVNLLCPGYVETELYEPITARI------
1ae1B           VIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKN-----P
3d5qA           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKA---------V
2c5aB           TNVSLKESDAWPAEPQDAFGLEKLATEELCKHYNKDF---GIECRIGRFHNIYGPFGTWKGGREKAPAAF
2bgkA           IVTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDV------FGVD
2e6eB           FSVPLEVPDFA--GLRPWLLRTLETLLRLERPFLV-----NVNLPLRPKGFLWTRQSVRAYEGVVIPGED
2aqkA           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAG
2aqhA           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAG
1cwuA           ISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEARKQNIRVNTISAGPLGSRAAKAIGFI-------
2b4qA           INIGSVAGISAMGEQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRHI---------A
3d7lA           FTLTTGIED-----PIVQGASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDK------------
3ctmD           LIITSSIKIVNIPQLQAPYNTAKAACTHLAKSLA-IEWAPFARVNTISPGYIDTDITDFASKDM------
1e3sA           GGQTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPS--------------
2c54B           TNVSLKESDAWPAEPQDAYGLERLATEELCKHYNKDF---GIECRIGRFHNIYG----------------
3e03A           ILTLAPPPSLNPAWWGAHTGYTLAKGSLVTLGLAAEFGPQGVAINALWPRTVIA----------------
1e6wD           GGNTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLT----------TL
2aw5A           IFASGSPFDPVTLPNGQTLYPGQGNNSYVFPG-------VALGVVACGLRQITDNIFLTTAEVIA-----
1e7sA           PMAESELLQGTLEPTNEPYAIARIAGIKLCESYN---RQYGRDYRSVMPTNLYGPHDN------------
2b37C           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTGALGEEAG------AQ
2eggA           VQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVIEALR--------------------------------
2dknB           EARAIELAE-QQGQTHLAYAGSKYAVTCLARRNVVDWAGRGVRLNVVAPGV-------------------
2a92C           VMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVL----------LK
1ae1A           VIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQKEEID-----------
2e6eD           NVNLPLRPK--------GFLWTRQSVRAYEGVVIPGEDPMGRPFYWFAPRPLKEAEEGTDRW--------
1e7qA           PMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGPHDN------------
3ctmB           LIITSSISGKIVNIPQLQYNTAKAACTHLAKSLAIEWAPFARVNTISPGYIDTDI------------TDF
2c5eB           TNVSLKESDAWPAEPQDAYGLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPF-----------GTW
3cxrA           IINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTAPLREL-------
2e37D           ILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARALSPEDRARI-----
3ctmE           LIITSSISGKIQLQAPYNTA--KAACTHLAKSLAIEWAPFARVNTISPGYIDTDITDFAS----------
3c2qB           ----------HSVATGNLPSYIKTVCVDIQPSTVTKLDRGTSQAIGVVTDVG------------------
2aq8A           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAG
2b36B           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTALGEEAGAQI------
3d7lD           LTTG-------IEDPIVQGASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDKL-----------
3bmnD           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLL------------PVAM
2eghA           LVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSG--------GP
1e3wA           GINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLT------------
2dteA           IVNISSVQASIITKNASAYVTSKHAVIGLTKSIALDYAPL-LRCNAVCPATIDTPLVRKAAELEVGSDPM
1bxkA           RFHHISTDEGDLHSTDDFFTETTASKASSDHLVRAWLRTYGLPTLITNCSNNYGPYHFPEKLIPLMILNA
1c9kB           VVLVTNEVGMGIVPENRLARHFRDI----AGRVNQRLAAAADEVWLVVSGIGVKI---------------
3donA           IYNGLDMFVHQGAESFKIWTNLEPDIKAMKNIVIQKLKGELL----------------------------
2b35C           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLLEEGWDQR-------
3diiA           IINIASTRAFQSEPDSEAYASAKGGIVALTHALA-MSLGPDVLVNCIAPGWINVTEF-------------
2c07A           IINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQI-----------
2b35D           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMEGWDQR-------
3ctmG           LIITSSISG--KIQLQAPYNTAKAA-CTHLAKSLAIEWAPFARVNTISPGYIDTDITDFASKDM------
1e7wA           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
1bdbA           I-FTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDLRGP----------S
3d64A           LVNLGCATGHPSTLAQIELFTRGGEYANKVYVLPKHLDEKVARLHLARIGAQLSELSDDQ---------A
1cbuC           VVLVTNEVGMGIV----PENRLARHFRDIAGRVNQRLAAAADEVWLVVSGI-------------------
2b35B           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTEEGWDQR---------
3d4nA           IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVSIVHMQAAP
3e6vA           IHLSFDVDGLDATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTA-----
1e6wA           GGQTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLT------------
2c59A           TNVSLKESDAWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKG------------
3cxtA           IINICSMMSELGRETVSAYAAAKGGLKMLTKNIASEYGEANIQCNGIGPGYIATPQTHPF----------
2axqA           ITVMNEIGLDPGIDHLYAVKTIDEVHRAGGKLKSFLSYCGGLPAPEDSDNPLGYKFSWSSRGVL------
1a9yA           QPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQ------
2bf7A           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
3ctmA           SLIITSSISGKIVQLQAPYNTAKAACTHLAKSLA-IEWAPFARVNTISPGYIDTDITDFASKDMKAKW--
3e9qB           LVFTSSSVGRQGRANWGAYAASKFATEGQVLA---DEYQQRLRVNCINPGGTRTARASAFPTEDPQKLKT
2bd0A           IFFITSVAATKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTP---------------
1e6wB           GINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLTFLASQ-------
1bdmA           TNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSIMF------------
3ctmC           LIITSSISGKIQLQAPYNTAKAACTHLAKSLA---IEWAPFARVNTISPGYIDTDITDFAS---------
2c7vD           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMG-----------
1cydA           SIVVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKV---------S
2bfaA           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
1bsvA           PMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGPHDN------------
3edmC           T-FSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGSSEDVAG--------------
1cg1A           AGGVATGSGLGPRYVDYVLGILKAYSTRVGAGFPTELF--------------------------------
2bfpB           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
1e92A           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
2c54A           TNVSLKESDAWPAEPQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPFCRKAQ
2bfmB           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
2bfoA           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
2bfaB           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
2a92B           VDVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVL-----------L
2cukA           LPNAVIT-----PHIGSAGRTTRERMAEVAVENLLAVLEGREPPNPV-----------------------
2c7vA           IVNL-CDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMG-----------
2c7vB           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMG-----------
3bmnC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
3edmD           VTFSSQAGRDGGGPGALAYATSKGAVMTFTRGLAKEVGPKIRVNAVCPGS--------------------
2e6gJ           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGVPDFALETLLRNVNLPLRPKGFLWTRQSVRAYEGVVIP---
3bmqC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
2b35F           SIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTQIQLLE----------
2bf7B           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
2e37C           GTILDTARLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARGRALSPEDRAR----------
3dijA           INIASTRAFQSEPDS-EAYASAKGGIVALTHALA-MSLGPDVLVNCIAPGWINVTFTQE-----------
1e7wB           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDWEGHRSKV------
1buaB           IFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKIKFTLGGYTSFIRN
3bmqA           IVNLCDAMVDQPMAF-SLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
1d4fA           LVNLGCAMGHPSFVMSNSFTNQVMAQIVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQ--------
1a7aB           NVSNSFTNQVAQIELWTHPDKYPVGVHFLPKKLDEA----VAEAHLGKLNVKLTKLTEKQAQYLGSCDGP
1b3rA           LVNLGCAMGHPSFVMSNSFTNQVMAQIEGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQ--------
1cg3A           AGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDGEFLCKQGNEFGAT----------------
3bmoD           V-NLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
3bmfB           IVNLCDAMVDQPMAFSL-YNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
2c59B           TNVSLKESDAWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGR----------
2c82A           AAVDSEHSALAQCLRGGTPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAHPTWSMGPM--NTLNSAS
3bmiB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
3bmkC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
1e92B           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV------------DDM
3bmeB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
2e37B           GTILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEA-----------RGR
2e37A           GTILDTARFRALLAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAEARALSPE--------------
3bmdB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEE----------
1c9kA           VVLVTNEVGMGIVPENRLARHFRDIAGRVNQ----RLAAAADEVWLVVSGIGVKI---------------
1e6wC           GGNTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLLT------------
1di6A           ILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPY-----VETAPE
3dtdB           KLAMTIAAPGEP-----PLNDLFVQLNGFSNALNRLIALQK-----------------------------
1a7aA           FVSNSFTNQVAQIELWTHPDKYPVGVHFLPKKLDEAVAE----AHLGKLNVKLTKLTEKQAQYLGSCDGP
1bdmB           VVGLIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRRMTVWGNHSSIMF------------
3bzuC           V-VVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVSITLCVLGLIDTETAMKAVMQ-------
3d7lB           FTLTTGI-----EDPIVQGASAAANGAVTAFAKSAAIEPRGIRINTVSPNVLEESWDKL-----------
3bmfC           IVNLCDAMVDQPMAFSL-YNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLGE---------------
2bfaD           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVHRSKV----------
3d7lF           FTLTTGIEDPIVQ-GASA--AANGAVTAF--AKSAAIEPRGIRINTVSPNVLEESWDKL-----------
2e37E           ILDTARFRALLAEYLRVAPQSVHAYVLGEHGDSEVLVWSSAQVGGVPLLEFAESPEDRAR----------
1ek5A           PQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHAS---------GCIGE
3bmfA           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEE----------
3dhnA           LFIAPGLRLDSGEVPENILPGVKALGEFYLN----FLKEKEIDWVFFSPAADRPGVRTGRY---------
3bmoA           LSIVCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
3bmnB           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
3bmoC           IVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
1adeA           AGGVATGSGLGPRYVDYVLGILKAYSTRVGAELFDETGEF------------------------------
2c7vC           IVNLCDAMVDQPMAFSL-YNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMG-----------
3bmjD           SIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
3bmfD           SIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
2b37B           GMDFDPSRAMPAYNWMTVAKSALESV---NRFVAREAGKYGVRSNLVAAGPIRTEGWDQR----------
1d0iA           SYVSQRADGVVAGCGVQGYVFGVERIAALA----------------------------------------
2bfaC           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVRSK------------
2eezA           ALTNQTLPYVLDAALLKGLNTHKGRLTHPGVAEAFGLP--YTPPEEALRG--------------------
3dbhC           PLLICRTYGLVGYMRIIIKEHPVIESHPDNALELREHFQSYDDMEDHSHTPWIVIIAKYLAQWYSETNGR
2bf7D           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVRSK------------
3d3jA           ALGLPLPLGEHAGRIYLCDIGIPQQVINYHSPFGCKFV--------------------------------
1e92D           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLY------
1a4uA           IANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHT----------F
1a4iB           GPMTVAMLM------QSTVESAKRFL--------------------------------------------
2a92A           VDVMVQLLFEHSGVPKIIGLGGVLDTSRLKYYISQKLNVCPRDVNALIVGAHGNKMVL------------
3bmeA           SIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
2e6gB           IWHSGTVAAAKQGYLFGLSAAAFSVPLNGERTLETLLRLENVNLPLRPKGFLWTRQSVRAYEGVVIPG--
2c5eA           TNVSLKESDAWPAEPQDAYGLEKLATEELCKHYNKD---FGIECRIGRFHNIYGPFGT------------
1cg4A           AGGVATGSGLGPRYVDYVLGILKAYSTPFPTELFDETGEF-LCKQGNEFGATTGLRRRTGWLDTV-AVRR
2c5aA           TNVSLKESDAWPAEPQDAFGLEKLATEELCKHYNKDF---GIECRIGRFHNIYGPFGTWKGGREKAPAAF
2bfoC           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLV---------------
2bfmC           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLY------
3dfzB           YTQFLYECRVLIHRLNVSKSRKHELLTEIIDDYRLSLVKQREFLQQI-----------------------
1bwsA           PMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGP---------------
3bmnA           NLCDAMV---DQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLP------------VAM
1a4iA           ----------------------------------------------------------------------
2e6gG           EIWHSGTVAAAKQGYLFGLSAAAFSVPLNGEVPDFRPFLVNVNLPLRPKGFLWTRQSVRAYEGVVIP---
3e9nA           I-----------YINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPTRPEI--------------
1e92C           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLY------
2bfpD           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLY------
2ef0A           ----------------------------------------------------------------------
1edzA           YVPMTGKVTI------------------------------------------------------------
2bf7C           IINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVGHRSKVPLY------
3e9nC           ----RAASGCVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGPEPKEIAN------------
3e9nB           I-----------YINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPIEPKEIANAIR--------FV
1civA           TNALICLKNAPNIPPKNFHALTRLDENRAKCQLALKAGVFYDKVSNVTIWGNHST---------------
3e9nD           --------GCVIYINNTIYAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIAN------------
1e6uA           PMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQ---YGRDYRSVMPTNLYGPHDNFHPSNSHVIPAL
3dqpA           ILLSTIFSLQPEKWIGAGFDALKDYYIAKHFADLYLTKETNLDYTIIQPGALTEEEATGLIDI-------
1b0aA           ----------------------------------------------------------------------
2c20A           EVDVDLITEETMTNPTNTYGETKLAIEKMLHWYSQA---SNLRYKIFRYFNVAGATPNGIIGE-------
2bkaA           FNLLSSKGADKSSNFLYLQVKGEVEAKVEEL--------KFDRYSVFRPGVLLCDRQESRPGEWLV----
2a35A           YLVVSALGA--DAKSSIFYNRVKGELEQALQEQ------GWPQLTIARPSLLFGPREEFRLAEILA---A
3dtdA           KLAMTIAAPGEPPLNDLFV---------------------------------------------------
3e9nE           ------------------YAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIAN------------
1bw3A           ----------------------------------------------------------------------
3e8xA           ----------------------------------------------------------------------
1ddtA           LSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADG---------A
3e9nH           ------------------YAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIAN------------
2e6gF           EIWHSGTVAAKQGYLFGLSAAA------------------------------------------------
3ejxD           IFNSGSEPEMCGNGVRCARFIAELENLQGKHSFTIHTGAGLIVPEIQDDGQVKVDMGTPILKAQDVPTKL
2dt8A           LERLRRDHFVRFSVATLEFLKRGGRIGGAQAFLGTLLNLKPV----------------------------
3dxfA           -----------AGRLAAAHFDGKGEVEEYFRDIGVPMTSVRLPCYFENLLSHFLPQKAPD----------
3e9nF           ------------------YAASKHALRGLADAFRKEEANNGIRVSTVSPGIEPKEIANAI----------
3c3xA           SDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANC--FASYFINYLLRPYDPKDEITVYGT
3bywC           ----------------------------------------------------------------------
1b93A           I---------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SEEQARAELAARNPQRRLVRPDEVADAVAWLCQPSASAITGQAVPVAGGEVMAG
1a27A           TDIHTFHRFSKQVFREAAQNPEEVAEVFLTAPKPTLRYFTTE------------
1dohB           LEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
3ce6B           ---------YLGVDVEGPYKPDHYR-----------------------------
2ae1A           --KENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMANC
3ch6E           PKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYN-----
1a9zA           DPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRD-------------
1dj2A           SCQINGFASLNLTKLDVLSDLNEIQLGVAYKRSDGTPVKS---FPG--------
3d3eA           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST--------
3deyX           RFYQYLAH-SKQVFREAAQNPEEVAEVF--------------------------
2d1yB           -AIRTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTASF
2belC           MQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIR-----------------
3ce6A           ---------YLGVDVEGPYKPDHYR-----------------------------
2cnbB           GSTHLIPIILGRVMSDIADKRMPIFGTDYPTPDGTCVRDYVHVCDLASAHILA-
3bzuB           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST--------
3d5qC           QAAPKEECALEIIKGGALRQEEVYYDSSLWLIRNPSRKILEF------------
2d1yA           --AIARRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTAS-
3czrA           KEECALEIIKGGALRQEEV-YYDSSLWTTLLIRNPSRKILEFLYSTSY------
3dwfB           PKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEELSAAEYNWDNV-
2aw5C           SLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQ------------
3dwfA           PKEECALEIIKGTALRQ-------------------------------------
3dwfC           PKEECALEIIKGTALRQDEMYYVGSRWVPYL-----------------------
3d3wA           SDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG-----
2a4kA           LPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI--
2belA           PKEECALEII---KGGALRQEEVYYDSSLWTT----------------------
2e6hD           -IPGEDPMGRPFYWFAPRPLKEAEEGTDRWAV--AQGFVSATPLRLDLT-----
3ce6D           ------------------------------------------------------
3bmoB           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH
2aw5B           SDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQ---------
3ch6B           PKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYN-----
3d5qD           --AAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRKILEF------------
1bmdA           -----FHAEVDGRPALELVDMEWYEKVF--------------------------
3e9qA           ---------FPTEDPQKLKTPADI--PLYLWLGDDSRRKTGTFDAQPGR-----
3ctmF           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTC--
2belB           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKI---------------
2d1yC           DPERTRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTAS-
3bhmA           PKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVE----------------
3csdB           HTEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGGLGN--
2aqiA           AQLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
3ch6D           PKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTS-------
2ag5A           NPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSLG-
2b35A           ---LEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
1c9yA           ------------------------------------------------------
2e6gK           --------PMGRPFYWFAPRPLKEAEEGTDRWAVAQGFVSATPLRLDLT-----
2e6cC           -IPGEDPMGRPFYWFAPRPLKEAEEGTDRWAV--AQGFVSATPLRLDLT-----
2belD           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKI---------------
1dfiA           -------------PIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAA
3ek2A           -----------NSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVV
3ctmH           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTC--
2b35E           -QLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
2cnbC           ------------------------------------------------------
1c3vA           HQEVLFGTEIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPL----------
2ehdB           --EDVAQAVLFALEMPGHAMVSEIELR---------------------------
2e6hB           -VVIPGEDPMGRPFYWFAPRPLKEAEEGTDRWAVAQGFVSATPLRLDLT-----
2d1yD           EAIATRRDWEDLHALRRLGKPEEVAEAVLFLASEKASFITGAILPVDGGMTAS-
3d5qB           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST--------
1edoA           LGEDMEKKILGTIPLGRTGQPENVAGLVEFLASPAASYITGQAFTIDGGIAI--
3e03C           ----------LPGVDAAACRRPEIADAAHAVLTREAAGFHGQFLIDDEVLAQAG
3e03B           ----------LPGVDAAACRRPEIADAAHAVLTREAAGFHGQFLIDDEVLAQAG
2ehdA           ALEMPGHAMVSEIELR--------------------------------------
3ek2D           --GKILDFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVV
2cfcA           ---ELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDGAYTA--
1c14A           DFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAA
1bxkB           LAGKSLPVYGNGQQIRDWLYVEDHARALYCVATTGKVGETYNIGGHNE------
2dfdA           ISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFS-
1d7oA           FIDTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMG
3byzA           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEF------------
2a4kB           ---------VGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSI--
2dknA           DPRYGESTRRFVAPLGRGSEPREVAEAIAFLLGPQASFIHGSVLFVDGGMDALM
3c6cA           -VRVGLEDNLYLSRGVFATNGQLVE-RARTVIEHLGSVATPDEARDIGL-----
3d3uA           ----------YGVARLRGATLRQRAEALTAIAHPDFRPLEEEIR----------
2cnbA           --GEHYQGSTHLIPIILGRVMSDIAPDDKRMPIFGT------------------
1ahhA           ITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQ--
3d4nB           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYST--------
3d4nC           MQAAPKEECALEIIKGGALRQEEVSLWTTLLIRNPSRKILEF------------
3ek2C           --GKILDFVESNSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVV
2ag5B           NPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSLG-
3edmB           ----------------REGSSEDVAGLVAFLASDDAAYVTGACYDINGGVLFS-
3ch6A           PKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDR--
3bzuA           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN-----
3e48A           YDKELAAILSEASGTEIKYEPVSLETFAEYDE----------------------
2ag5C           NPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL--
1b8pA           ------------------------------------------------------
3dfzA           ------------------------------------------------------
2ae2A           EQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGGLMAN-
1bhsA           TDIHTFHRFSKQVFREAAQNPEEVAEVFLTAPKPTLRYFTTE------------
3dxfB           -KMPEKYVGQNIGLSTCRHTAEEYAALLTK------------------------
3cq0B           PLNLLEQLYESTDPIENKLNSESEGVEKVSFINDEPHFRYVLNEDQMATEKL--
3bmeC           -----DKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVH
3bzuD           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEF------------
2b4qB           NDPQALEADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFHL--
1dohA           LEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
3d3eB           PKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEF------------
3d4nD           KEE-----CALEIIKGGALRQEEVYYDTTLLIRNPSRKILEF------------
2e6hC           -VVIPGEDPMGRPFYWFAPRPLKEAEEGTDRWAVAQGFVSATPLRL--------
2e6bD           PMGRPFYWFAPRPL------KEAEEGTDRWAV--AQGFVSATPLRL--------
1dhrA           -------------DFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTT-----
2e6cD           -VVIPGEDPMGRPFYWFAPRPLKEAEEGTDRWAVAQGFVSATPLRL--------
2ekpA           QNPELYEPITARIPMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLA--
3ek2B           -----------NSPLKRNVTIEQVGNAGAFLLSDLASGVTAEVMHVDSGFNAVV
2e6bC           PMGRPFYWFAPRPL------KEAEEGTDRWAVA--QGFVSATPLRL--------
3dooA           ------------------------------------------------------
2e6gA           DPMGRPFYWFAPRPLKEAEEGTDRW-----------------------------
1d4gA           ---------YLGMPINGPFKPDHYR-----------------------------
1di7A           ------------------------------------------------------
1dj3A           CCDINGFSSLNLTKLDVLSGLPEIKLGVSYNQMDGLQSFPGDLDTLEQVQVN--
3c2qA           ------------------------------------------------------
3edmA           ------------------GSSEDVAGLVAFLASDDAAYVTGACYDINGGVLFS-
2c29F           ------------------------------------------------------
2ekqD           -------------PMGRWARPEEIARVAAVLCGDEAEYLTGQAVAVDGGFLA--
1ae1B           HQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG
3d5qA           MQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSY--
2c5aB           CRKAQTSMWGDGLQTRSFTFIDECVEGVLRLTKSDFREP---------------
2bgkA           SSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTN
2e6eB           PMGRPFYWFA-----PRPLKEAEEGTDRWAV---AQGFVSATPLRL--------
2aqkA           AQLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
2aqhA           AQLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
1cwuA           --DTMIEYSYNNAPIQKTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMG
2b4qA           NDPQALEADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGGFHL--
3d7lA           -----------LEPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV--------
3ctmD           -----KAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTC--
1e3sA           ----------QVPFPSRLGDPAEYAHLVQMVI--ENPFLNGEVIRLDGAIRMQ-
2c54B           ------------------------------------------------------
3e03A           -----------TGVDAAACRRPEIADAAHAVLTREAAGFHGQFLIDDEVLAQAG
1e6wD           PDKVRNFLASQVPFPSRLGDPAEYAHLVQMVI--ENPFLNGEVIRLDGAIRMQ-
2aw5A           -QQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEA-
1e7sA           ------------------------------------------------------
2b37C           IQLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
2eggA           ------------------------------------------------------
2dknB           ------------APLGRGSEPREVAEAIAFLLGPQASFIHGSVLFVDGGMDAL-
2a92C           RYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLL------------
1ae1A           -------NFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG
2e6eD           ------------------------------------------------------
1e7qA           ------------------------------------------------------
3ctmB           ASKDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGGYTC--
2c5eB           KGGREAAPAAFCRKAQTSTDRFEMWGDGLQTRS---------------------
3cxrA           --HPFDQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAYI
2e37D           --DEGVRRAAYRIIEGKGATYYGIGAGLARLVRAILTDEKG-------------
3ctmE           --KDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
3c2qB           ------------------------------------------------------
2aq8A           AQLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
2b36B           -QLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
3d7lD           ------------EPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV--------
3bmnD           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2eghA           FRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLE------------
1e3wA           --TVRNFLASQVPFPSRLGDPAEYAHLVQMVI--ENPFLNGEVIRLDGAIRMQ-
2dteA           RIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCLYVDGGLSIRA
1bxkA           LAGKSLPVYGNGQQIRDWLYVEDHARALYCVAT---------------------
1c9kB           ------------------------------------------------------
3donA           ------------------------------------------------------
2b35C           -----------APIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
3diiA           -----TQEDCAAIPAGKVGTPKDISNMVLFLC--QQDFITGETIIVDGGMSKRM
2c07A           -----KKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGG-----
2b35D           -----------APIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
3ctmG           -----KAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
1e7wA           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
1bdbA           SLGPLADMLKSVLPIGRMPEVEEYTGAYVFFARGDAAPATGALLNYDGGLGVRG
3d64A           AYIGVSKAGPFKPDHYR-------------------------------------
1cbuC           ------------------------------------------------------
2b35B           -----------APIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
3d4nA           KEE-----CALEIIKGGALRQEEVYYDSSLLIRNPSRKILEF------------
3e6vA           ------------------------------------------------------
1e6wA           --KVRNFLASQVPFPSRLGDPAEYAHLVQMVI--ENPFLNGEVIRLDGAIRMQ-
2c59A           ------------------------------------------------------
3cxtA           -----DQFIIAKTPAARWGEAEDLMGPAVFLASDASNFVNGHILYVDGGILAY-
2axqA           ------LALRNSAKYWKDGKIETVSSEDLMATAKPYFIYPGYAFVCYP------
1a9yA           ---GIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVM--------
2bf7A           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
3ctmA           ---------WQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
3e9qB           PADIPLY----------------------LWLGDDSRRKTGTFDAQPGRKPG--
2bd0A           -----MWGKVDDEMQALMMMPEDIAAPVVQAYLQPSRTVVEEIIRPTSGDI---
1e6wB           -----------VPFPSRLGDPAEYAHLVQMVI--ENPFLNGEVIRLDGAIRMQ-
1bdmA           --PDLFHAEVDGRPALELVDMEWYEKVF--------------------------
3ctmC           --KDMKAKWWQLTPLGREGLTQELVGGYLYLASNASTFTTGSDVVIDGG-----
2c7vD           -EEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
1cydA           ADPEFARKLKERHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS-
2bfaA           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
1bsvA           ------------------------------------------------------
3edmC           --------------------------LVAFLASDDAAYVTGACYDING------
1cg1A           ------------------------------------------------------
2bfpB           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
1e92A           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2c54A           TSTDRFEMWGDGLQTRSFTFIDECVEGVLRLT----KSDFREPVNIGSDEMV--
2bfmB           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2bfoA           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2bfaB           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2a92B           KRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYV------
2cukA           ------------------------------------------------------
2c7vA           -EEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2c7vB           -EEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmnC           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3edmD           --------------------SEDVAGLVAFLASDDAAYVTGACYDING------
2e6gJ           -----GEDPMGRPFYWFAPRPLKEAEEGTDRWAVAQGFVSATPLRL--------
3bmqC           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2b35F           -----EGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
2bf7B           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2e37C           ------------------------------------------------------
3dijA           --------DCAAIPAGKVGTPKDISNMVLFLC--QQDFITGETIIVDGGMSKRM
1e7wB           ------------PLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
1buaB           FDQYIAHWIIGYVYTRSL-KTYNINELNEIPKPYKGVKVFLQDKWVIAGDL---
3bmqA           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
1d4fA           ---------YLGMPINGPFKPDHYR-----------------------------
1a7aB           FKPDH-------------------------------------------------
1b3rA           ---------YLGMPINGPFKPDHYR-----------------------------
1cg3A           ------------------------------------------------------
3bmoD           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmfB           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2c59B           ------------------------------------------------------
2c82A           LVNKGLEVIETHLLFGIPYDRIDVVVHPQSIIHSMVTFIDGSTIAQASPPDMKL
3bmiB           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
3bmkC           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
1e92B           PPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
3bmeB           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
2e37B           ALSPEDRARIDEGVRRAAYRIIEGKGATYYGIGAGLARLVRAILTDEKGVYTVS
2e37A           ------------------------------------------------------
3bmdB           ---EKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
1c9kA           ------------------------------------------------------
1e6wC           -----NFLASQVPFPSRLGDPAEYAHLVQMVI--ENPFLNGEVIRLDGAIRMQ-
1di6A           VVAAFRPKSARR------------------------------------------
3dtdB           ------------------------------------------------------
1a7aA           KPDHYR------------------------------------------------
1bdmB           --PDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAI---------------
3bzuC           --AAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYS-----
3d7lB           ------------EPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV--------
3bmfC           --EEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
2bfaD           ------------PLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
3d7lF           ------------EPFFEGFLPVPAAKVARAFEKSVFGAQTGESYQV--------
2e37E           ---------IDEGVRRAAYRIIEGKGATYYGIGAGLARLVRAILTDEKGVYT--
1ek5A           DPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVV--------
3bmfA           ---EKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
3dhnA           ---RLGKDDIVDIVGNSHISVEDYAAAIDELEHP---KHHQERFTIGYLE----
3bmoA           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
3bmnB           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmoC           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
1adeA           ------------------------------------------------------
2c7vC           -EEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
3bmjD           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
3bmfD           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2b37B           -----------APIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
1d0iA           ------------------------------------------------------
2bfaC           -----------VPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2eezA           ------------------------------------------------------
3dbhC           IPKTYKEKEDFRDLEDEENFEEAIKNVNTALNTTQIP-----------------
2bf7D           -----------VPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
3d3jA           ------------------------------------------------------
1e92D           ---------------QRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTR
1a4uA           NSWLDVEPRVAELLLSHPTQTSEQCGQNFVKA--IEANKNGAIWKLDLGTLEA-
1a4iB           ------------------------------------------------------
2a92A           ------------------------------------------------------
3bmeA           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGG-----
2e6gB           ------------------------------------------------------
2c5eA           ------------------------------------------------------
1cg4A           AVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPPLAADDWKGVEPIY--ETMPG
2c5aA           CRKAQTSMWGDGLQTRSFTFIDECVEGVLRLTK---------------------
2bfoC           -----DGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTR
2bfmC           ---------------QRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
3dfzB           ------------------------------------------------------
1bwsA           ------------------------------------------------------
3bmnA           GEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSL--
1a4iA           ------------------------------------------------------
2e6gG           ------------------------------------------------------
3e9nA           -----------------YIEPKEIANAIRFVIAGETTQITNVDV----------
1e92C           ---------------QRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2bfpD           ---------------QRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSL--
2ef0A           ------------------------------------------------------
1edzA           ------------------------------------------------------
2bf7C           ---------------QRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTR
3e9nC           ------------------------------------------------------
3e9nB           IDAGETTQITNVDVRPRI------------------------------------
1civA           ------------------------------------------------------
3e9nD           ------------------------------------------------------
1e6uA           LRRFHEATAQKAPDVVVWGSGTHVDDMAAASIHVMELAHEVWLENTQPMLSH--
3dqpA           -----------NDEVSASNTIGDVADTIKELVTD---HSIGKVISHNGKTAIK-
1b0aA           ------------------------------------------------------
2c20A           -DHRPETHLIPLVLQVALGQREKIMMFGDDYN----------------------
2bkaA           --RKFFGSLPDSWASGHSVPVVTVVRAMLNNV--VRPRDKQMELLENKAIHDLG
2a35A           PIAGKYHGIEACDLARALWRALEEGKGVRFVESDELRKLGKGS-----------
3dtdA           ------------------------------------------------------
3e9nE           ------------------------------------------------------
1bw3A           ------------------------------------------------------
3e8xA           ----------HFSEITRSITRHDVAKVIAELV--DQQHTIGKTFEVLNGDTP--
1ddtA           VHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQ-----
3e9nH           ------------------------------------------------------
2e6gF           ------------------------------------------------------
3ejxD           SGNKGEAVVEALVVDGVSWNVTCVSMGNPHCITFGKKG----------------
2dt8A           ------------------------------------------------------
3dxfA           -GKSYLLSLPTGDVPMDGMSVSDLGPVVLSLLKM-PEKYVGQNIGLSTCRH---
3e9nF           --RFVIDAGETTQITNVDVRP---------------------------------
3c3xA           -----------GEAKFAMNYEQDIGLYTIKVATDPRA--LNRVVIYRPS-----
3bywC           ------------------------------------------------------
1b93A           ------------------------------------------------------