[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09298.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cb4D.bssp"
#ERROR : Can't open dsspfile "3degC.bssp"
#ERROR : Can't open dsspfile "2e1rA.bssp"
#ERROR : Can't open dsspfile "3dpuA.bssp"
#ERROR : Can't open dsspfile "1darA.bssp"
#ERROR : Can't open dsspfile "2brvX.bssp"
#ERROR : Can't open dsspfile "2efgA.bssp"
#ERROR : Can't open dsspfile "2bm0A.bssp"
#ERROR : Can't open dsspfile "2bm1A.bssp"
#ERROR : Can't open dsspfile "2dy1A.bssp"
#ERROR : Can't open dsspfile "2bv3A.bssp"
#ERROR : Can't open dsspfile "1d8tA.bssp"
#ERROR : Can't open dsspfile "1eftA.bssp"
#ERROR : Can't open dsspfile "1d2eA.bssp"
#ERROR : Can't open dsspfile "3cw2B.bssp"
#ERROR : Can't open dsspfile "1dg1G.bssp"
#ERROR : Can't open dsspfile "2ahoA.bssp"
#ERROR : Can't open dsspfile "2b7cA.bssp"
#ERROR : Can't open dsspfile "1d8tB.bssp"
#ERROR : Can't open dsspfile "2d74A.bssp"
#ERROR : Can't open dsspfile "1aipA.bssp"
#ERROR : Can't open dsspfile "3chuB.bssp"
#ERROR : Can't open dsspfile "1efcA.bssp"
#ERROR : Can't open dsspfile "2c77A.bssp"
#ERROR : Can't open dsspfile "2bvnA.bssp"
#ERROR : Can't open dsspfile "1efuA.bssp"
#ERROR : Can't open dsspfile "2dcuA.bssp"
#ERROR : Can't open dsspfile "2cnuA.bssp"
#ERROR : Can't open dsspfile "1eguA.bssp"
#ERROR : Can't open dsspfile "2bvnB.bssp"
#ERROR : Can't open dsspfile "3chuA.bssp"
#ERROR : Can't open dsspfile "2cnqA.bssp"
#ERROR : Can't open dsspfile "1egaB.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "1egaA.bssp"
#ERROR : Can't open dsspfile "2cnvA.bssp"
#ERROR : Can't open dsspfile "3ea5C.bssp"
#ERROR : Can't open dsspfile "1b23P.bssp"
#ERROR : Can't open dsspfile "1aipE.bssp"
#ERROR : Can't open dsspfile "3bihA.bssp"
#ERROR : Can't open dsspfile "2c78A.bssp"
#ERROR : Can't open dsspfile "3bc1A.bssp"
#ERROR : Can't open dsspfile "3bb4A.bssp"
#ERROR : Can't open dsspfile "3bigA.bssp"
#ERROR : Can't open dsspfile "1a4xB.bssp"
#ERROR : Can't open dsspfile "2b3nA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3ec5A.bssp"
#ERROR : Can't open dsspfile "2cjwA.bssp"
#ERROR : Can't open dsspfile "2dykA.bssp"
#ERROR : Can't open dsspfile "1aztB.bssp"
#ERROR : Can't open dsspfile "1aym1.bssp"
#ERROR : Can't open dsspfile "2e87A.bssp"
#ERROR : Can't open dsspfile "3bjqE.bssp"
#ERROR : Can't open dsspfile "3a1sA.bssp"
#ERROR : Can't open dsspfile "1dapA.bssp"
#ERROR : Can't open dsspfile "1ceeA.bssp"
#ERROR : Can't open dsspfile "1ajeA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "2dfkD.bssp"
#ERROR : Can't open dsspfile "1an0B.bssp"
#ERROR : Can't open dsspfile "3bc1E.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "2b6hA.bssp"
#ERROR : Can't open dsspfile "2byeA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1byuA.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"
#ERROR : Can't open dsspfile "1ecrA.bssp"
#ERROR : Can't open dsspfile "3e5hA.bssp"
#ERROR : Can't open dsspfile "3ea5A.bssp"
#ERROR : Can't open dsspfile "3bfkB.bssp"
#ERROR : Can't open dsspfile "3a1vA.bssp"
#ERROR : Can't open dsspfile "2dfkB.bssp"
#ERROR : Can't open dsspfile "1a2kE.bssp"
#ERROR : Can't open dsspfile "1a4rA.bssp"
#ERROR : Can't open dsspfile "1cc0A.bssp"
#ERROR : Can't open dsspfile "1byuB.bssp"
#ERROR : Can't open dsspfile "2dwqA.bssp"
#ERROR : Can't open dsspfile "2aseA.bssp"
#ERROR : Can't open dsspfile "2c5zA.bssp"
#ERROR : Can't open dsspfile "2atxA.bssp"
#ERROR : Can't open dsspfile "3bb3A.bssp"
#ERROR : Can't open dsspfile "1an0A.bssp"
#ERROR : Can't open dsspfile "3doeA.bssp"
#ERROR : Can't open dsspfile "1a2kD.bssp"
#ERROR : Can't open dsspfile "2bkuA.bssp"
#ERROR : Can't open dsspfile "2bmjA.bssp"
#ERROR : Can't open dsspfile "2cxxC.bssp"
#ERROR : Can't open dsspfile "2a5fA.bssp"
#ERROR : Can't open dsspfile "2ahjD.bssp"
#ERROR : Can't open dsspfile "3ddcA.bssp"
#ERROR : Can't open dsspfile "3conA.bssp"
#ERROR : Can't open dsspfile "1e0sA.bssp"
#ERROR : Can't open dsspfile "1dpfA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "1c82A.bssp"
#ERROR : Can't open dsspfile "2c5lA.bssp"
#ERROR : Can't open dsspfile "3e3xA.bssp"
#ERROR : Can't open dsspfile "1as3A.bssp"
#ERROR : Can't open dsspfile "1aztA.bssp"
#ERROR : Can't open dsspfile "2bjnB.bssp"
#ERROR : Can't open dsspfile "2al7A.bssp"
#ERROR : Can't open dsspfile "621pA.bssp"
#ERROR : Can't open dsspfile "3c5hA.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "1c1yA.bssp"
#ERROR : Can't open dsspfile "3d5bF.bssp"
#ERROR : Can't open dsspfile "3bfkA.bssp"
#ERROR : Can't open dsspfile "1d5cA.bssp"
#ERROR : Can't open dsspfile "121pA.bssp"
#ERROR : Can't open dsspfile "1cf4A.bssp"
#ERROR : Can't open dsspfile "2dbyA.bssp"
#ERROR : Can't open dsspfile "3brwD.bssp"
#ERROR : Can't open dsspfile "3cx7A.bssp"
#ERROR : Can't open dsspfile "3eg5A.bssp"
#ERROR : Can't open dsspfile "3eg5B.bssp"
#ERROR : Can't open dsspfile "1ds6A.bssp"
#ERROR : Can't open dsspfile "2cxxA.bssp"
#ERROR : Can't open dsspfile "3batA.bssp"
#ERROR : Can't open dsspfile "3bh6A.bssp"
#ERROR : Can't open dsspfile "1cluA.bssp"
#ERROR : Can't open dsspfile "3basB.bssp"
#ERROR : Can't open dsspfile "3dz8A.bssp"
#ERROR : Can't open dsspfile "521pA.bssp"
#ERROR : Can't open dsspfile "3a1tA.bssp"
#ERROR : Can't open dsspfile "2bmeB.bssp"
#ERROR : Can't open dsspfile "1doaA.bssp"
#ERROR : Can't open dsspfile "1e96A.bssp"
#ERROR : Can't open dsspfile "3bh7A.bssp"
#ERROR : Can't open dsspfile "2e9sA.bssp"
#ERROR : Can't open dsspfile "3batC.bssp"
#ERROR : Can't open dsspfile "3a1uB.bssp"
#ERROR : Can't open dsspfile "1am4D.bssp"
#ERROR : Can't open dsspfile "2a5dA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "3cwzA.bssp"
#ERROR : Can't open dsspfile "3basA.bssp"
#ERROR : Can't open dsspfile "3dpbB.bssp"
#ERROR : Can't open dsspfile "3defA.bssp"
#ERROR : Can't open dsspfile "2cldX.bssp"
#ERROR : Can't open dsspfile "2bnxA.bssp"
#ERROR : Can't open dsspfile "3bbpA.bssp"
#ERROR : Can't open dsspfile "3cqgB.bssp"
#ERROR : Can't open dsspfile "1cxzA.bssp"
#ERROR : Can't open dsspfile "2c2hA.bssp"
#ERROR : Can't open dsspfile "221pA.bssp"
#ERROR : Can't open dsspfile "1d1nA.bssp"
#ERROR : Can't open dsspfile "3a1vB.bssp"
#ERROR : Can't open dsspfile "2bmeC.bssp"
#ERROR : Can't open dsspfile "1bh2A.bssp"
#ERROR : Can't open dsspfile "2ce2X.bssp"
#ERROR : Can't open dsspfile "2d7cA.bssp"
#ERROR : Can't open dsspfile "2efcB.bssp"
#ERROR : Can't open dsspfile "3batB.bssp"
#ERROR : Can't open dsspfile "2dpxB.bssp"
#ERROR : Can't open dsspfile "3dsnC.bssp"
#ERROR : Can't open dsspfile "2ahjB.bssp"
#ERROR : Can't open dsspfile "1a2bA.bssp"
#ERROR : Can't open dsspfile "3cf6R.bssp"
#ERROR : Can't open dsspfile "2bcgY.bssp"
#ERROR : Can't open dsspfile "2b3mA.bssp"
#ERROR : Can't open dsspfile "2bcjQ.bssp"
#ERROR : Can't open dsspfile "3ch5A.bssp"
#ERROR : Can't open dsspfile "3a1sB.bssp"
#ERROR : Can't open dsspfile "2aedA.bssp"
#ERROR : Can't open dsspfile "3c5cB.bssp"
#ERROR : Can't open dsspfile "2bmeA.bssp"
#ERROR : Can't open dsspfile "1chpD.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "3efxD.bssp"
#ERROR : Can't open dsspfile "2crvA.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "2bmdA.bssp"
#ERROR : Can't open dsspfile "2efhB.bssp"
#ERROR : Can't open dsspfile "2c2hB.bssp"
#ERROR : Can't open dsspfile "2e9sB.bssp"
#ERROR : Can't open dsspfile "2clsB.bssp"
#ERROR : Can't open dsspfile "3c5cA.bssp"
#ERROR : Can't open dsspfile "2clsA.bssp"
#ERROR : Can't open dsspfile "3bjiD.bssp"
#ERROR : Can't open dsspfile "2dwqB.bssp"
#ERROR : Can't open dsspfile "3bfkE.bssp"
#ERROR : Can't open dsspfile "3dosE.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1ahjB.bssp"
#ERROR : Can't open dsspfile "1byiA.bssp"

## Summary of PDB Search
:597
    e-105  59%  3cb4D  [x.x.x] GTP-BINDING PROTEIN LEPA
    3e-87  63%  3degC  [x.x.x] GTP-BINDING PROTEIN LEPA
    2e-67  13%  2e1rA  [x.x.x] ELONGATION FACTOR 2
    3e-58  10%  3dpuA  [x.x.x] RAB FAMILY PROTEIN
    1e-52  19%  1darA  [x.x.x] ELONGATION FACTOR G
    1e-48  10%  2brvX  [x.x.x] HYALURONATE LYASE
    2e-48  19%  2efgA  [c.37.1 - b.43.3 - d.14.1 - d.58.11] PROTEIN (ELONGATION
    2e-48  16%  2bm0A  [x.x.x] ELONGATION FACTOR G
    1e-44  17%  2bm1A  [x.x.x] ELONGATION FACTOR G
    1e-41  20%  2dy1A  [x.x.x] ELONGATION FACTOR G
    1e-38  19%  2bv3A  [x.x.x] ELONGATION FACTOR G
    5e-36  19%  1d8tA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    4e-33  18%  1eftA  [x.x.x] ELONGATION FACTOR TU
    1e-32  19%  1d2eA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU (EF-TU)
    2e-32  13%  3cw2B  [x.x.x] TRANSLATION INITIATION FACTOR 2 SUBUNIT GAMMA
    1e-31  19%  1dg1G  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-31  13%  2ahoA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    1e-30  17%  2b7cA  [x.x.x] ELONGATION FACTOR 1-ALPHA
    5e-30  21%  1d8tB  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-29  16%  2d74A  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    1e-29  20%  1aipA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    5e-29   7%  3chuB  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    8e-29  20%  1efcA  [c.37.1 - b.43.3 - b.44.1] PROTEIN (ELONGATION FACTOR)
    8e-29  21%  2c77A  [x.x.x] ELONGATION FACTOR TU-B
    6e-28  22%  2bvnA  [x.x.x] ELONGATION FACTOR TU
    1e-27  21%  1efuA  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    3e-27  16%  2dcuA  [x.x.x] TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    3e-27  14%  2cnuA  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    5e-27  10%  1eguA  [a.102.3 - b.30.5 - b.24.1] HYALURONATE LYASE
    9e-27  22%  2bvnB  [x.x.x] ELONGATION FACTOR TU
    1e-26   5%  3chuA  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    5e-26  15%  2cnqA  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    7e-26  12%  1egaB  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    7e-26  12%  1eg7A  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    2e-25  16%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-25  13%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-25  13%  1egaA  [c.37.1 - d.52.3] PROTEIN (GTP-BINDING PROTEIN ERA)
    5e-24  12%  2cnvA  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE
    5e-24  14%  3ea5C  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    6e-24  19%  1b23P  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    1e-23  22%  1aipE  [c.37.1 - b.43.3 - b.44.1] ELONGATION FACTOR TU
    2e-22  13%  3bihA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    2e-22  22%  2c78A  [x.x.x] ELONGATION FACTOR TU-A
    4e-22  15%  3bc1A  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    9e-21  12%  3bb4A  [x.x.x] T7I23.11 PROTEIN
    9e-21  11%  3bigA  [x.x.x] FRUCTOSE-1,6-BISPHOSPHATASE CLASS II GLPX
    1e-20  13%  1a4xB  [c.61.1] PYRIMIDINE OPERON REGULATORY PROTEIN PYRR
    2e-20  11%  2b3nA  [x.x.x] HYPOTHETICAL PROTEIN AF1124
    2e-20  16%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-19  12%  3ec5A  [x.x.x] OUTER SURFACE PROTEIN A
    2e-19  11%  2cjwA  [x.x.x] GTP-BINDING PROTEIN GEM
    3e-19  20%  2dykA  [x.x.x] GTP-BINDING PROTEIN
    5e-19  15%  1aztB  [c.37.1 - a.66.1] GS-ALPHA
    7e-19   9%  1aym1  [b.121.4] HUMAN RHINOVIRUS 16 COAT PROTEIN
    1e-18  14%  2e87A  [x.x.x] HYPOTHETICAL PROTEIN PH1320
    1e-18   9%  3bjqE  [x.x.x] PHAGE-RELATED PROTEIN
    2e-18  16%  3a1sA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    5e-18  13%  1dapA  [c.2.1 - d.81.1] DIAMINOPIMELIC ACID DEHYDROGENASE
    6e-18  13%  1ceeA  [c.37.1] GTP-BINDING RHO-LIKE PROTEIN
    7e-18  12%  1ajeA  [x.x.x] CDC42HS
    7e-17  16%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-17  11%  2dfkD  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    1e-16  11%  1an0B  [c.37.1] CDC42HS-GDP
    2e-16  10%  3bc1E  [x.x.x] RAS-RELATED PROTEIN RAB-27A
    3e-16  17%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-16  12%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    4e-16  10%  2b6hA  [x.x.x] ADP-RIBOSYLATION FACTOR 5
    4e-16  11%  2byeA  [x.x.x] PHOSPHOLIPASE C, EPSILON 1
    6e-16  18%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-16  13%  1byuA  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    6e-16  15%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    1e-15   6%  1ecrA  [e.2.1] PROTEIN (REPLICATION-TERMINATOR PROTEIN)
    2e-15  12%  3e5hA  [x.x.x] RAS-RELATED PROTEIN RAB-28
    3e-15  13%  3ea5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    4e-15  17%  3bfkB  [x.x.x] SMALL GTPASE RAB11
    8e-15  18%  3a1vA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-14  13%  2dfkB  [x.x.x] CELL DIVISION CYCLE 42 ISOFORM 1
    2e-14  16%  1a2kE  [c.37.1] RAN
    2e-14  13%  1a4rA  [c.37.1] G25K GTP-BINDING PROTEIN
    2e-14  12%  1cc0A  [c.37.1] TRANSFORMING PROTEIN RHOA
    3e-14  11%  1byuB  [c.37.1] PROTEIN (GTP-BINDING PROTEIN RAN)
    3e-14  12%  2dwqA  [x.x.x] GTP-BINDING PROTEIN
    3e-14  12%  2aseA  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    3e-14  13%  2c5zA  [x.x.x] SET DOMAIN PROTEIN 2
    3e-14  11%  2atxA  [x.x.x] SMALL GTP BINDING PROTEIN TC10
    5e-14   6%  3bb3A  [x.x.x] T7I23.11 PROTEIN
    6e-14  12%  1an0A  [c.37.1] CDC42HS-GDP
    1e-13  16%  3doeA  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2
    1e-13  14%  1a2kD  [c.37.1] RAN
    1e-13  16%  2bkuA  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    1e-13  14%  2bmjA  [x.x.x] CENTAURIN GAMMA 1
    2e-13  14%  2cxxC  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    2e-13  16%  2a5fA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-13   9%  2ahjD  [b.34.4] NITRILE HYDRATASE
    3e-13  26%  3ddcA  [x.x.x] GTPASE HRAS
    3e-13  21%  3conA  [x.x.x] GTPASE NRAS
    3e-13  14%  1e0sA  [c.37.1] ADP-RIBOSYLATION FACTOR 6
    4e-13  12%  1dpfA  [c.37.1] RHOA
    5e-13  16%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    6e-13  15%  1c82A  [a.102.3 - b.30.5 - b.24.1] HYALURONATE LYASE
    9e-13  22%  2c5lA  [c.37.1 (1he8B)] GTPASE HRAS
    1e-12  18%  3e3xA  [x.x.x] BIPA
    1e-12  11%  1as3A  [x.x.x] GIA1
    1e-12  14%  1aztA  [c.37.1 - a.66.1] GS-ALPHA
    2e-12  12%  2bjnB  [x.x.x] TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6B
    2e-12  18%  2al7A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE 10C
    2e-12  19%  621pA  [x.x.x] H-RAS P21 PROTEIN
    2e-12   9%  3c5hA  [x.x.x] GLUCOCORTICOID RECEPTOR DNA-BINDING FACTOR 1
    2e-12  16%  1a2kC  [c.37.1] RAN
    3e-12  19%  1c1yA  [c.37.1] RAS-RELATED PROTEIN RAP-1A
    3e-12  20%  3d5bF  [x.x.x] 50S RIBOSOMAL PROTEIN L4
    3e-12  12%  3bfkA  [x.x.x] SMALL GTPASE RAB11
    4e-12  17%  1d5cA  [c.37.1] RAB6 GTPASE
    8e-12  25%  121pA  [c.37.1 (1bkdR)] H-RAS P21 PROTEIN
    1e-11  17%  1cf4A  [c.37.1] PROTEIN (CDC42 HOMOLOG)
    1e-11  15%  2dbyA  [x.x.x] GTP-BINDING PROTEIN
    1e-11  16%  3brwD  [x.x.x] RAS-RELATED PROTEIN RAP-1B
    1e-11  11%  3cx7A  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN GALPHA 13
    2e-11  12%  3eg5A  [x.x.x] CELL DIVISION CONTROL PROTEIN 42 HOMOLOG
    2e-11   7%  3eg5B  [x.x.x] PROTEIN DIAPHANOUS HOMOLOG 1
    2e-11  14%  1ds6A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
    2e-11  13%  2cxxA  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    2e-11  17%  3batA  [x.x.x] MYOSIN HEAVY CHAIN, STRIATED MUSCLE/GENERAL
    4e-11  19%  3bh6A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    6e-11  16%  1cluA  [c.37.1] TRANSFORMING PROTEIN P21/H-RAS-1
    7e-11  25%  3basB  [x.x.x] MYOSIN HEAVY CHAIN, STRIATED MUSCLE/GENERAL
    1e-10  15%  3dz8A  [x.x.x] RAS-RELATED PROTEIN RAB-3B
    1e-10  21%  521pA  [x.x.x] H-RAS P21 PROTEIN
    1e-10  21%  3a1tA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-10  15%  2bmeB  [x.x.x] RAS-RELATED PROTEIN RAB4A
    3e-10  11%  1doaA  [c.37.1] PROTEIN (GTP-BINDING PROTEIN)
    4e-10  19%  1e96A  [c.37.1] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    4e-10  18%  3bh7A  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3
    4e-10  15%  2e9sA  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    5e-10  25%  3batC  [x.x.x] MYOSIN HEAVY CHAIN, STRIATED MUSCLE/GENERAL
    5e-10  21%  3a1uB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    6e-10  14%  1am4D  [c.37.1] CDC42HS
    6e-10  16%  2a5dA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    7e-10  12%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    9e-10  15%  3cwzA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    1e-09  25%  3basA  [x.x.x] MYOSIN HEAVY CHAIN, STRIATED MUSCLE/GENERAL
    1e-09  12%  3dpbB  [x.x.x] F1 CAPSULE ANTIGEN
    1e-09  10%  3defA  [x.x.x] T7I23.11 PROTEIN
    2e-09  27%  2cldX  [x.x.x] GTPASE HRAS
    2e-09   7%  2bnxA  [x.x.x] DIAPHANOUS PROTEIN HOMOLOG 1
    3e-09  19%  3bbpA  [x.x.x] RAS-RELATED PROTEIN RAB-6A
    3e-09   6%  3cqgB  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP133
    4e-09  13%  1cxzA  [c.37.1] PROTEIN (HIS-TAGGED TRANSFORMING PROTEIN RHOA(0-
    5e-09  12%  2c2hA  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
    6e-09  25%  221pA  [x.x.x] H-RAS P21 PROTEIN
    7e-09  18%  1d1nA  [b.43.3] INITIATION FACTOR 2
    1e-08  14%  3a1vB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-08  20%  2bmeC  [x.x.x] RAS-RELATED PROTEIN RAB4A
    1e-08  14%  1bh2A  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN
    1e-08  23%  2ce2X  [x.x.x] GTPASE HRAS
    2e-08  17%  2d7cA  [x.x.x] RAS-RELATED PROTEIN RAB-11A
    2e-08  14%  2efcB  [x.x.x] SMALL GTP-BINDING PROTEIN-LIKE
    3e-08  23%  3batB  [x.x.x] MYOSIN HEAVY CHAIN, STRIATED MUSCLE/GENERAL
    9e-08  12%  2dpxB  [x.x.x] GTP-BINDING PROTEIN RAD
    9e-08  12%  3dsnC  [x.x.x] F1 CAPSULE ANTIGEN
    9e-08   9%  2ahjB  [b.34.4] NITRILE HYDRATASE
    9e-08  13%  1a2bA  [x.x.x] TRANSFORMING PROTEIN RHOA
    1e-07  14%  3cf6R  [x.x.x] RAS-RELATED PROTEIN RAP-1B
    4e-07  12%  2bcgY  [x.x.x] GTP-BINDING PROTEIN YPT1
    4e-07  14%  2b3mA  [x.x.x] HYPOTHETICAL PROTEIN AF1124
    5e-07  15%  2bcjQ  [x.x.x] G ALPHA I1, GUANINE NUCLEOTIDE-BINDING PROTEIN
    5e-07  16%  3ch5A  [x.x.x] GTP-BINDING NUCLEAR PROTEIN RAN
    6e-07  21%  3a1sB  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    7e-07  17%  2aedA  [x.x.x] RAS-RELATED PROTEIN RAB-14
    9e-07  13%  3c5cB  [x.x.x] RAS-LIKE PROTEIN 12
    1e-06  21%  2bmeA  [x.x.x] RAS-RELATED PROTEIN RAB4A
    1e-06   9%  1chpD  [b.40.2] CHOLERA TOXIN B PENTAMER
    1e-06  17%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    1e-06  10%  3efxD  [x.x.x] CHOLERA ENTEROTOXIN SUBUNIT B, HEAT-LABILE
    4e-06  15%  2crvA  [x.x.x] TRANSLATION INITIATION FACTOR IF-2
    6e-06  12%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    1e-05  17%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    2e-05  17%  2bmdA  [x.x.x] RAS-RELATED PROTEIN RAB4A
    3e-05  11%  2efhB  [x.x.x] SMALL GTP-BINDING PROTEIN-LIKE
    3e-05  13%  2c2hB  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
    4e-05  22%  2e9sB  [x.x.x] RAS-RELATED PROTEIN RAB-6B
    5e-05  14%  2clsB  [x.x.x] RHO-RELATED GTP-BINDING PROTEIN RHO6
    7e-05  12%  3c5cA  [x.x.x] RAS-LIKE PROTEIN 12
    1e-04   8%  2clsA  [x.x.x] RHO-RELATED GTP-BINDING PROTEIN RHO6
    1e-04  20%  3bjiD  [x.x.x] RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
    1e-04  11%  2dwqB  [x.x.x] GTP-BINDING PROTEIN
    1e-04  13%  3bfkE  [x.x.x] SMALL GTPASE RAB11
    3e-04  13%  3dosE  [x.x.x] F1 CAPSULE ANTIGEN
    3e-04  20%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    4e-04  14%  1ahjB  [b.34.4] NITRILE HYDRATASE (SUBUNIT BETA)
    0.001  14%  1byiA  [c.37.1 (1bs1A)] DETHIOBIOTIN SYNTHASE
:597

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDHIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAALSYKARDGQV
3cb4D           ---------------RNFSIIAHIST--------------LSDRIIQICGGQSVTL-----DYKASDGET
3degC           MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDLERERGITIKAQSVTLDYKASDGET
2e1rA           ----------------------------------------------------------------------
3dpuA           ----YFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGGLNVVTKQA-PNIKGLENDDELKE
1darA           -KRLRNIGIAAHIDAGKTTTTERILYYTGRAAVTTCFWKDHRINIIDTPQGVEPQSETVWRQAEKYKVPR
2brvX           ---------------------------------------VKDTYTDRLDDWNGIIAGNQYYDS-------
2efgA           LKRLRNIGIAAHIDAGKTTTTERILYYTGRIAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAI
2bm0A           -KRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIATITAVFDSSQGVEPQSETVWRQAE---KYKVPRIA
2bm1A           -KRLRNIVIAAHIDAGKTTTTERILYYTGREVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPR
2dy1A           ---IRTVALVGHAGSGKTTLTEALLYKTGAKERREEGTTTTDYTPEAKLHRTTVRTGVAPLLFRGHRV--
2bv3A           ----------------------------------------------------------------------
1d8tA           ---HVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARFDQIDNAPEEKARGITINTSHVEYDTP-----T
1eftA           ---HVNVGTIGHVDHGKTTLTAALTFVTAAENPNVEVKDDIDKAPEERARGITINTAHVEYETAK-----
1d2eA           ---HVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEIDNAPEERARGITINAAHVEYSTAARHYAH
3cw2B           -QPEVNIGVVGHVDHGKTTLVQAITGIWTSTIKLGYAETNIGVCESKKPEAYVTEPSCKSCGSDDEPKFL
1dg1G           ---HVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFQIDNAPEEKARGITINTSHVEYDTPTRHYAH
2ahoA           ---EVNIGVVGHVDHGKTTLVQAITGIWTSGMTIKLGYAETNIGVCESCKKYVTEPSCKSCGSDDEPKFL
2b7cA           ---HINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGKAERERGITIDIALWKFETPK
1d8tB           ---HVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFQIDNAPEEKARGITINTSHVEY-----DTPT
2d74A           -QAEVNIGMVGHVDHGKTTLTKALTGVWTDTLRRGIKIGFADAEIRRCSNCGRYSTSPICPYCGHETEFI
1aipA           ---HVNVGTIGHVDHGKTTLTAALTY-------------------VTAAENPTAHVEYETAKRH------
3chuB           -------------------------------------------GRLVRRRA-AVVNKAD----------I
1efcA           ---HVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARFDQIDNAPEEKARGITINTSHVEYDTP-----T
2c77A           ---HVNVGTIGHVDHGKTTLTAALTYVTAAENPNVEDYGDIDKAPEERARGITINT-----AHVEYETAK
2bvnA           ---HVNVGTIGHVDHGKTTLTAAIT------------TVLAKTYGGEKARGITINTSHVEYDTPT-----
1efuA           ---HVNVGTIGHVDHGKTTLTAAI------------------TTVLAKTYGGTSHVEY--------DTPT
2dcuA           -QAEVNIGMVGHVDHGKTTLTKALTGVWTDTHSEELRIGFADAEIRRCSNCGRYSTSPICPYCGHETEFI
2cnuA           ----------------------------------------------------------------------
1eguA           -----------------------------------------DTYTDRLDDWNGIIAGNQYYDSKND----
2bvnB           ---HVNVGTIGHVDHGKTTLTAAI-------------TTVLAKT--YGARGITINTSHVEYDTPT-----
3chuA           ------------------------------------------------------------------RAWP
2cnqA           ----------------------------------------------------------------------
1egaB           -SYCGFIAIVGRPNVGKSTLLNKLLGQKISITS-----------RKAQTTRHRIVGIHTEGAYQAIYVDT
1eg7A           TPAFIHGGPFANIAHGCNSIIATKTALKL---ADYVVTEAGFGADLGAEKFYDVKCRYAGFKPDA-----
1cjtC           -----------------------------------QDDYVPSDQDLLRCRVLTSGIFETKF-----QVDK
1cs4C           ALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGIF-----ETKFQVDK
1egaA           -SYCGFIAIVGRPNVGKSTLLNKLLGQKI------SITSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHM
2cnvA           ----------------------------------------------------------------------
3ea5C           -----KLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT------------------NRGP
1b23P           -KPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEDYGDIDKAPEERARGITINT-----AHVEYETAK
1aipE           ---HVNVGTIGHVDHGKTTLT------------------------------AALTYVTAAENPAHVETAK
3bihA           MR--RELAIFSRVTESA---ALAGYKWLGRGDKNTADGAAVNAMRIMLNQVIVIGEGEIAEAPMLYIGKV
2c78A           ---HVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVYGDIDKAPEERARGITINTAHVEYETAK-----
3bc1A           YDYLIKFLALGDSGVGKTSVLYQYTDGKF--------NSKFITTVGIDFREKRVVYRANGPDGAVGRGQR
3bb4A           --------FQQFPAATQEKLIEFFGKLKQKDMNSMVGKSSTVNSLIGEQVVRVSP--FLRPVMVSRTMGG
3bigA           ------------------------------TADGAAVNAMRIMLNQVNIDGTIVIGEIAEAPMLYIGEKV
1a4xB           --KGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTV---GEIDITLYDEPLVKGADIPVDITDQKVI-
2b3nA           ----------------------------------------------------------------------
3c14C           ALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGIFETKF-----QVDK
3ec5A           LFNEKGELSEKKITRADKSSTYELFNEKGELSLKYITRARLEYTGIKSDGSGKAKEVLKGYVLE-GTLTA
2cjwA           -----RVVLIGEQGVGKSTLANIFAG---------------VHDSEVLGEDTYER-----TLMVDGESAT
2dykA           ----HKVVIVGRPNVGKSSLFNRLLKKRSDLKEGVVETD-----------------------RGRFLLVD
1aztB           ALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGIFETKF-----QVDK
1aym1           ------------------------------------------NPVERYVDEVLNEVLV---------VPN
2e87A           DLEIPTVVIAGHPNVGKSTLLKALTTAKPEIASYPFTTRGINVGQFEDGYFRYQII------DTPGLLDR
3bjqE           ----------------------------------------------------------------------
3a1sA           ----VKVALAGCPNVGKTSLFNALTG---------------TKQYVANWPGVTVEKKEGVFTYKGYTINL
1dapA           ----------------------------------------------------------------------
1ceeA           MQTI-KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP
1ajeA           -MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLG---------------
1cjuC           ALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGIFETKF-----QVDK
2dfkD           HMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP
1an0B           -----KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVIGGEPYTLGLFDTAGQEDYDRLRPL
3bc1E           YDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAGQRIHLQ-------------
1culC           -----------------------------------QDDYVPSDQDLLRCRVLTSGIFETKF-----QVDK
1eg7B           ----------------------------------------------------------------------
2b6hA           ----------------SRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFN---VETVEYKN
2byeA           ----------------------------------------------------------------------
3c15C           -----------------------------------------SDQDLLRCRVLTSGI-----FETKFQVDK
1byuA           -QVQFKLVLVGDGGTGKTTFVKRHLTGEF------------------EKKYVPTLGVEVHPLVFHTNRGP
2cxxB           --------FAGRSNVGKSTLIYRLTGKKVRRKIIEIEWKNHKIIDPGFGFGLP---------KEVQERIK
1ecrA           ---LLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQ---SLALRHFRHLFIQQQSENRSSKAAVRLPG
3e5hA           HMRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKM
3ea5A           -QVQFKLVLVGDGGTGKTTFVKRHLTGE-------------FEKKYVATLGVEVHPLVFHTNRGPIKFNV
3bfkB           -DYLFKIVLIGDSGVGKSNLLSRFTRDEFNLESKSTIGVEFATKSIQLKNNKIIKAQI------------
3a1vA           --HMVKVALAGCPNVGKTSLFNALTG---------------TKQYVANWPGVTVEKKEGVFTYKGYTINL
2dfkB           MQTI-KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP
1a2kE           --VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNV-------------
1a4rA           MQTI-KCVVVGDVAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMI---------------GGEPYTLG
1cc0A           ----KKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELA---------------
1byuB           PQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPLVFHTNRGPIK---------------F
2dwqA           ---MLAVGIVGLPNVGKSTLFNALTRANALAATIDKNVGVPLEDERLYALQRTFAKG-----ERVPPVVP
2aseA           -----KCVVVGDGAVGKTCLLISYTTNKLPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP
2c5zA           ----------------------------------------------------------------------
2atxA           -ALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDR---
3bb3A           TQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNS------LIGEQVVRVSPF-GLRPVMVSRTMGG
1an0A           -----KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVIGGEPYTLGLFDTAGQEDYDRLRPL
3doeA           -ERELRLLMLGLDNAGKTTILKKFNGED------------------IDTISPTLGFNIKTLEHRGFKLNI
1a2kD           --VQFKLVLVGDGGTGKTTFVKRHLTGEF------------------EKKYVATLGVEVHPLVFHTNRGP
2bkuA           -----KLVLVGDGGTGKTTFVKRHLTGEFEKKYVPTLGVEVHPL------------------VFHTNRGP
2bmjA           MRSIPELRLLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLI---------------
2cxxC           --------FAGRSNVGKSTLIYRLTGKKVRGVTRKIIEIEWKNHKIIDPGFGFG------LPKEVQERIK
2a5fA           -----RILMLGLDAAGKTTILYKLKLGQ-------------SVTTIPTVGFNVETVT-----YKNVKFNV
2ahjD           -----LAGGPFPLSRPSESEGRPAPVETTTFEVGQRVVRDEYVPGHIRMPAYCRGRVGTISHR-----TT
3ddcA           ---------------GKSALTIQLIQNHF--------VEKYDPTIEDSYRKQVVI-----------DGET
3conA           -------------------------------------------------------------EYDPTIEDS
1e0sA           --------------VLSKIFGNKEMRILMLGLDAAGKTTILYKLGQSVTTIPTVGFNVETVTYKNVKFNV
1dpfA           ---RKKLVIVGDVACGKTCLLIVFSKDQFPAVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRARP
1cjvC           ALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGIF-----ETKFQVDK
1c82A           -----------------------------------------DTYTDRLDDWNGIIAGNQYYDSKND----
2c5lA           --------VVGAVGVGKSALTIQL----------------IQNHFVDEYDPTIEDSYRKQVVI---DGET
3e3xA           ----------------------------------------------------------------------
1as3A           ----KDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPYIPTQQDVLRTRVKTTGIV-----ETHFTFKD
1aztA           ALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQDDYVPSDQDLLRCRVLTSGIF-----ETKFQVDK
2bjnB           ----------------------------------------------------------------------
2al7A           -------------------------------SKEEMELTLVGLQYSGKTTFVNVIAVGF--NMRKVTKGN
621pA           ---------------GKSALTIQL----------------IQNHFVDEYDPTIEDSYRKQVVI---DGET
3c5hA           ----GTEKEKGQCGIGKSCLCNRFVRPSADEFHLDQTEFIDDQTFQPHRSTALQPYIKRAAATKLASAEK
1a2kC           --VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNV-------------
1c1yA           ------------------------------------------------------------------DCQQ
3d5bF           --HLLWEVVRWRGTASTKTRGEVA------YSGRKIWPQKHTGRARHGDIGAPIFVGGGVV-----FGPK
3bfkA           --------------------------------DYLFKIVLIGDSGVGKSNLLSRFTRDEFNLGVEFATKS
1d5cA           --------FLGEQAVGKTSIITRFYDTFDNNYQSTIGIDFLSKTLYLD-------------------EGP
121pA           ---------------GKSALTIQLIQN----------------HFVDEYDPTIEDSYRK---QVVIDGET
1cf4A           MQTI-KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEP-------------------
2dbyA           -----AVGIVGLPNVGKSTLFN-ALTRANALAIDKNVGVVPLEDERLYALQRTFAKGERVPPVVP-----
3brwD           -------------------------------------------------------------------AQQ
3cx7A           ALWEDSGIQNAYDRRREFQLGESVKYFLDNLDKLGVPDYIPSQQDILLARRPTKGIHEYDF-----EIKN
3eg5A           MQTIK-CVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP
3eg5B           AKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQL------------
1ds6A           MQAI-KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRP
2cxxA           --------FAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDPGFGFGL-PKEVQERIK
3batA           ----------------------------------------------------------------------
3bh6A           --------LLGLDNAGKTTLLKQLASEDI------------------SHITPTQGFNIKSVQSQGFKLNV
1cluA           MTEYK-LVVVGAPGVGKSAL--------------------TIQLIQNHFVDEDSYRKQVVIDGETCLLDI
3basB           ----------------------------------------------------------------------
3dz8A           FDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKL---------------
521pA           --------VVGAVGVGKSALTIQLIQN----------------HFVDEYDPTIEDSYRK---QVVIDGET
3a1tA           --HMVKVALAGCPNVGKTSLFNA-------LTGTKQYVANWPGVTVEKKEGVFTYKG-------------
2bmeB           -DFLFKFLVIGNAGTGKSCLLHQFIEKK-------------FKDDSNHTIGVEFGSKIINVGGKYVKLQI
1doaA           HMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRP
1e96A           -----KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVM-------------------VDGKP
3bh7A           --------LLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQ------------------SQGFKLNV
2e9sA           --------FLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRT------------------
3batC           ----------------------------------------------------------------------
3a1uB           --HMVKVALAGCPNVGKTSLFNALTG-----------TKQYVANTVEKKEGVFTY-------------KG
1am4D           --------VVGDGAVGKTCLLISYTTNKFYVPTVFDNYAVTVMIGGEPYTLGLFDTAG------------
2a5dA           -----RILMLGLDAAGKTTILYKLKLGQS------------------VTTIPTVGFNVETVTYKNVKFNV
3cbqA           --------LVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGWL
3cwzA           --------FLGEQSVGKTSLITRFMYDSFDNTYQAT------------------IGIDFLSKTMYLEDRT
3basA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
3defA           --------FQQFPAATQEKLIEFFGKLKGGVGKSSVNSLIGEQVVRVSPFQAGLRPVMVSR-----TMGG
2cldX           ------------------------------------------------------------------DGET
2bnxA           AKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIA------------LKVGCLQL
3bbpA           --------FLGEQSVGKTSLITRFMYDSF------------------DNTYQATIGIDFLSKTMYLEDRT
3cqgB           ----------------------------------------------------------------------
1cxzA           -AIRKKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP
2c2hA           --------VVGDGAVGKTCLLISYTTNAFPGDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL------
221pA           ---------------GKSALTIQLIQ------NHFVDEYDPTIEESYRK-------------QVVIDGET
1d1nA           ----------------------------------------------------------------------
3a1vB           ---MVKVALAGCPNVGKTSLFNALTGTKQ----------------YVANWPGVTVEKKEVFTYKGYTINL
2bmeC           -DFLFKFLVIGNAGTGKSCLLHQFIEKK------------------FKDDSNHTIGVEFGSKIINVGGKY
1bh2A           -------------------------------------------QDVLRTRVKTTGIVETHF-----TFKD
2ce2X           ---------------GKSALTIQL----------------IQNHFVDECDPTIEDSYRK---QVVIDGET
2d7cA           -DYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATR------------------SIQVDGKT
2efcB           --------LLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAV------------------NDAT
3batB           ----------------------------------------------------------------------
2dpxB           -----------------------------------------------------------------IFGGV
3dsnC           ----------------------------------------------------------------------
2ahjB           --LESLAGGPFPLSRPSESEGRPAPVETTTFEVGQVRVRDEYVPGHIRMPAYCRGRVGTISHRTT-----
1a2bA           ----KKLVIVGDVACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTA----------
3cf6R           -----------------------------------------------------VEKYDPTIEDSYRKQVQ
2bcgY           -DYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL--------------DGKTVKLQ
2b3mA           ----------------------------------------------------------------------
2bcjQ           -----------------------------------------TQQDVLRVRVPTTGIIEYP-----FDLQS
3ch5A           -QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL------------------VFHTNRGP
3a1sB           -----KVALAGCPNVGKTSLFNALTGTKQYVANW-------PGVTVEKKEGVFTY-------------KG
2aedA           ----------------------------------------------------------------------
3c5cB           -------------------------------------------------------------------HQP
2bmeA           -DFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINV------------------GGKY
1chpD           ----------------------------------------------------------------------
2a78A           --------MVGSGGVGKSALTLQF-------------------MYDEFVEDYEPTKADSYRKKVVLDGEE
3efxD           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1agpA           MTEYK-LVVVGADGVGKSALTIQLIQNHFVDEYDPTI--------------EDSYRKQVVIDGETCLLDI
2bmdA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2c2hB           ---MQAIKCVGDGAVGKTCLLISYTTNAFPGEYIDNYSANVMVDGKPVNLG-------------------
2e9sB           ----------------------------------------------------------------------
2clsB           --------LVGDVQCGKTAMLQVL-------------------AKDCYPETYVPTVFENYTACLETEEQR
3c5cA           --------ILGRRGAGKSALTVKFLTKRFISEYDPNLEDTYSSEETVDHQPV------------------
2clsA           VVARCKLVLVGDVQCGKTAMLQVLAKDC---------------YPETYVPTVFENYTACLETEEQRVELS
3bjiD           --------VVGDGAVGKTCLLISYTTNAFPGYIPTVFDN-----------------------YSANVMKP
2dwqB           --------IVGLPNVGKSTLFNALTRANALAKNVGVVPLEDERLYALQRTFAKGERVPPVVPTHVE----
3bfkE           -DYLFKIVLIGDSGVGKSNLLSRFTR---------------DEFNLGVEFATKS-----------IQLKI
3dosE           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1ahjB           ---------------------------------------DEYVPGHIRMPAYCRGRVGTISHRTT-----
1byiA           --------------------------------------------------------------------QQ


                         .         .         *         .         .         .         .:140
query           YNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPQADP
3cb4D           YQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADP
3degC           YQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADP
2e1rA           -------------------------------------------EIVLKGDEKDLEGKALLKVVMRKFLPA
3dpuA           CLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYN
1darA           IAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDIIDVLRMKAYTYGNDLGTDIREIPIPEEYL
2brvX           ------KNDQMAKLNQELEGKVADSLSSILWEKFSNYKTSAN--LTATYRKLEEMAKQVTNPSSRYYQDE
2efgA           NKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYL
2bm0A           FANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMYTYGNDLGTDIREIPIPEEYL
2bm1A           IAFANKMDKTGADLRTMQERLGARPVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYL
2dy1A           ---FLLDAPGYGDFVGEIRGALEAADAALVAVSAEAGVQVGTERAWTVAERLGLPRMVVVTKLDKGGDYY
2bv3A           ----------------------------------------------------------------------
1d8tA           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVYIIVFLNKCDMVDDEE
1eftA           RHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVMNKVDMVDDPE
1d2eA           T-----DCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEVVVYVNKADAVQDSE
3cw2B           RRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIVKNLIIVQNKVDVVSKEE
1dg1G           V-----DCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVYIIVFLNKCDMVDDEE
2ahoA           RRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIVKNLIIVQNKVDVVSKEE
2b7cA           YQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREGVRQLIVAVNKMDSVKWDE
1d8tB           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVYIIVFLNKCDMVDDEE
2d74A           RRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
1aipA           --YSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVYIVVFMNKVDMVDDPE
3chuB           LDEWADYDTLVPDYPLEIVPFA--------EHPLFLAAEPHQRQRVLTGMWIGYNERVIATEQLIAEPAF
1efcA           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVYIIVFLNKCDMVDDEE
2c77A           RHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVYIVVFMNKVDMVDDPE
2bvnA           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVYIIVFLNKCDMVDDEE
1efuA           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVYIIVFLNKCDMVDDEE
2dcuA           RRVSFIDSPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIQKNIIIAQNKIELVDKEK
2cnuA           -----------------------------------------------------------ITKTELDGILP
1eguA           QMAKLNQELEGKVA-----DSLSSISSQADRIYLWEKFSNYKTSANLTATYRKLEAKQVTNPSSRYYQDE
2bvnB           RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVYIIVFLNKCDMVDDEE
3chuA           RRAAVVNKADILDEWADYDTLVPLEIVPFAEHPLFLAAEPHQRQRVLTGMWIGYNERVITEQLIAEPAFD
2cnqA           -----------------------------------------------------------ITKTELDGILP
1egaB           PGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNKVDNVQEKA
1eg7A           -----TVIV-ATVRALKMHGGVPKSDLATENLEALREGFANLEKHIENIGKFGVPAVVAINAFPTDTEAE
1cjtC           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQETISVILFLNKQDLLAEKV
1cs4C           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAISVILFLNKQDLLAEKV
1egaA           EE-----KRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNKVDNVQEKA
2cnvA           -----------------------------------------------------------ITKTELDGILP
3ea5C           IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKD
1b23P           RHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVYIVVFMNKVDMVDDPE
1aipE           RHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVYIVVFMNKVDMVDDPE
3bihA           GTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADN
2c78A           RHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVYIVVFMNKVDMVDDPE
3bc1A           IHLQLWDTAGLERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLYSENPDIVLCGNKSDLEDQR
3bb4A           FTINIIDTPGLVEAGYVNHLVNRTIDVLLYVDRLDVYRVDELDKQVVIAITQTFGKEIVLTHAQFSPPDE
3bigA           GTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADN
1a4xB           LVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHREL-------------PIRADYIGKNIPTSKS
2b3nA           ----------------------------------------------------------------------
3c14C           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAISVILFLNKQDLLAEKV
3ec5A           EKTTLVVKEGTVTLSKNISKSGEVSVELNAATKKTAAWNSGTSTLTITVNSKKTKDLITVQQYDSNGTSL
2cjwA           IILLDMWENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREV
2dykA           TGGLWSGDKWEKKIQEKVDRALEDAEVVLFAVDGRAELTQADYEVAEYLRRKGKPVILVATKVDDPKHE-
1aztB           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQETISVILFLNKQDLLAEKV
1aym1           INQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYN
2e87A           PISERNEIEKQAILALRYLGNLIIYIFDPSEHCGFPLEEQIHLFEEVHGEFKDLPFLVVINKIDVADEEN
3bjqE           ---------------------VAQYGGKILTFGKEAFRLYNTKRAPGANTKRIDFGYEGDPYSIVPSALE
3a1sA           IDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQ--SLYLLLELEEKKVILATAIDEAKKTG
1dapA           ----------------------------------------------------------------------
1ceeA           LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITP
1ajeA           LFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPS
1cjuC           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQRTISVILFLNKQDLLAEKV
2dfkD           LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITP
1an0B           SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQI----DLRDDPSTIEKLAKNKQKP
3bc1E           LWDTAGLERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYSENPDIVLCGNKSDLEDQR
1culC           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAISVILFLNKQDLLAEKV
1eg7B           KCRYAGFKPDATVIVATVRALVPKSDLATENLEALREGFANLEKHIENIGKFGVPAVVAINAFPTDTEAE
2b6hA           ICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMP
2byeA           HRVTVHGVPGPEPFTVFTINGGTKAKQLLQQILTNEQDIKPVTTDYFLM---EEKYFISKEKNECRKQPF
3c15C           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRWLRTISVILFLNKQDLLAEKV
1byuA           IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKD
2cxxB           DEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQ
1ecrA           VLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITVLHDPATLRFGWAN
3e5hA           LDKYIYGAQGVLLVYDITNY-------------QSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEH
3ea5A           W-----DTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKD
3bfkB           -----WDTAGQERYRAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDIVILLVGNKSDLKH--LR
3a1vA           IDLPGTYSLGYSSIDEKIARDYLLKGDALVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTG
2dfkB           LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITH---HCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKP
1a2kE           -----WDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPCGNKVDIKDRKV
1a4rA           LFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPS
1cc0A           LWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEH
1byuB           NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKV
2dwqA           THVEFVDIAGLVKGAHKFLAHIREVAAIAHVLRCFPDPD-------------------------------
2aseA           LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITP
2c5zA           ----------------------------------------------------------------------
2atxA           LRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKP
3bb3A           FTINIGYVNHQALELIKGFLVNRTIDVLLYVDRLDVYRVDELDKQQTFGKEIWCKTLLVLTHAQFSPPDE
1an0A           SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRD----DPSTIEKLAKNKQKP
3doeA           WDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALS
1a2kD           IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKD
2bkuA           IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPCGNKVDIKDRKV
2bmjA           -----REEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSP
2cxxC           DEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQ
2a5fA           WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
2ahjD           EKWPFPDAIGHGRNDAGEEPFGSDTDGGSVVVDLFEGYLEP-----------------------------
3ddcA           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRDVPMVLVGNKCDLAARTV
3conA           YRKQVVIDGETCLLDILDTAGMRTGEGFLCVFAINNSKSFADINLYREQIKRVVPMVLVGNKCDLPTRTV
1e0sA           WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
1dpfA           LSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTARELAKMKQEPVKP
1cjvC           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQETISVILFLNKQDLLAEKV
1c82A           QMAKLNQELEG-----KVADSLSSISSQADRIYLWEKFSNYKTSANLTATYRKLEAKQVTNPSSRYYQDE
2c5lA           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDMVLVGNKCDLAARTV
3e3xA           ----------------------------------------------------------------------
1as3A           LHFKMFDVGGQFEGVTAIIFCVALSDYDLVM-NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKI
1aztA           VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAISVILFLNKQDLLAEKV
2bjnB           ----------------------------------------------------------------------
2al7A           VTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLQGIPVLVLGNKRDLPNALD
621pA           CLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDPMVLVGNKCDLA-AR
3c5hA           LMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRNFDDQLKFVSNLYNQLAKPIVVVLTKCDEGVE
1a2kC           -----WDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPCGNKVDI---KD
1c1yA           CMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDMILVGNKCDLEDERV
3d5bF           PRDYSYTLPKKVRKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDSESVLLVTGNELVRR
3bfkA           IQLNNKIIKAQIWDTAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELSNIVILLVGNKSDLKHLRVI
1d5cA           VRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDIGKDVIIALVGNKTDLGDLRK
121pA           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQISDDVPMVLVGNKCDLAART-
1cf4A           YTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHTPFLLVGTQIDLRDDPS
2dbyA           THVEFVDIAGLVKGAHKGEGHIREVAAIAHVLRCFPD---------------------------------
3brwD           CMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
3cx7A           VPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRQTNRLTESVSIILFLNKTDLLEEKV
3eg5A           LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITP
3eg5B           INALITPAEELDFRVHIRSELMRLGLHQQELREIENEDMKVQLCVFDEQGEDFFDLKGRLDDIRMEMDDF
1ds6A           LSYPQTDVFLICFSL---------------VSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKD
2cxxA           DEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQ
3batA           --------------------------------------------------EEMKEQLKQMDKMKEDLAKT
3bh6A           WDIGGLRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAP
1cluA           LDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTV
3basB           -------------------------------------------------------------------AKT
3dz8A           ---QIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATYSWDNAQVILVGNKCDMEEERV
521pA           CLLDILDTTGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
3a1tA           YTINLIDLPGTYSLGYKIARDYLLKGDAILVADSVNPEQSLYLLLE--ILEMEKKVILAMTAIDE--AKK
2bmeB           WDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREV
1doaA           LSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITP
1e96A           VNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKD
3bh7A           WDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAP
2e9sA           VRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNLNSFQQTSKWIDDVRTERGSDVIIMLVGNKTDLA
3batC           -------------------------------------------------------------------AKT
3a1uB           YTINLIDLPGTYSLGYKIARDYLLKGDAILVADSVNPEQSLYLLL--EILEMEKKVILAMTAIDE--AKK
1am4D           ------QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPS
2a5dA           WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
3cbqA           RDHCLQTGDAFL------------IVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSRE
3cwzA           VRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLA
3basA           -------------------------------------------------------------------AKT
3dpbB           ---------------------------------------------------------------DLTASTT
3defA           FTINIIDTPGLVEALIKGFLVNRTIDVLLYVDRLDVYAVDELDKQVVIAITQTFGTLLVLTHAQFSPPDE
2cldX           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQISDDVPMVLVGNKSDLAARTV
2bnxA           INALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEM
3bbpA           VRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRSDVIIMLVGNKTDLA-DKR
3cqgB           -------------KAHATLLGLANMETRYFAKKKTLLGLSKLAA-----LASDFSEDMLQEKIEEMAEQE
1cxzA           LSYPDTDVILMCFSIDSPDSLENIP---------------EKWTPEVKHFCPNVPIILVGNKKDLRNDEH
2c2hA           -----SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLDKKLAP
221pA           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQISDDVPMVLVGNKCDLA--AR
1d1nA           ----------------------------------------------------------------------
3a1vB           IDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLEILEMEKKVILAMTKKTGMKIDR
2bmeC           VKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMIVIILCGNKKDLDADREV
1bh2A           LHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDECNNKWFTDTSIILFLNKKDLFIKKS
2ce2X           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDMVLVGNKSDLAARTV
2d7cA           IKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELDSNIVILVGNKSDLRH--LR
2efcB           VKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLL
3batB           -----------------------------------------------------------MDKMKEDLAKT
2dpxB           EHTYDRSIVVDGEEASLMVYDIWMGDAYVIVYSVTDKGSFEKASELRVQLRRAVPIILVGNKSDLVR-SR
3dsnC           ----------------------------------------------------------------------
2ahjB           EKWPFPDAIGHGRNDAGEEPFGSDTDGGSVVVDLFEGY--------------------------------
1a2bA           -----GQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEH
3cf6R           CMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
2bcgY           IWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKD-KR
2b3mA           ----------------------------------------------------------------------
2bcjQ           VIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEQNSSVILFLNKKDLLEPEY
3ch5A           IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPCGNKVDIKDRKV
3a1sB           YTINLIDLPGTYSLGYSSIDLKGDADLVILVADSVNPEQ-----SLYLLLEILEEKVILATAIDEAKKTG
2aedA           IEVSGQKIKLQIWDTAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTTNPNTVIILIGNKADLEAQRDV
3c5cB           VHLRVMDTADLDTPRNCERYLNWAHAFLVVYVDSRQSFDSSSLALHAKETQRSIPALLLGNKLDMAQYRQ
2bmeA           VKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLAIVIILCGNKKDLDADR
1chpD           ------------------------------ITDLCAEYQIHTLNDKIFSYTESLADKRIITFKNGATFQV
2a78A           VQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADILRVKEDENVPFLLVGNKSDLEDKR
3efxD           -------------------------------QNITELCSEYHNTQIYTINDAGKREMAIITFKNGATFQV
2crvA           ----------------------------------------------------------------------
1azsC           ----------TAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKV
1agpA           LDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTV
2bmdA           -----------------------------------------------------VIILCGNKKDLDA--DR
2efhB           --------------------------------------------------------LAGNKSDL--LDAR
2c2hB           LWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKD
2e9sB           ------------------------STVAVVVYDITNLNSFQQTSKWIDDVGSDVIIMLVGNKTDLAD-KR
2clsB           VELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTECPSTRVLLIGCKTDLRTDLS
3c5cA           ---HLRVMDTADPRNCERYLNWAHAFLVVYSVDSRQSFDSELLALHAKETQRSIPALLLGNKLDMAQYRQ
2clsA           LWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLS
3bjiD           VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPECPNTPIILVGTKLDLRDDKK
2dwqB           ----FVDIAGLVN---QFLAHIREVAAIAHVLRCFPD---------------------------------
3bfkE           IKAQIWDTARAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNIVILLVGNKSDLKHLRVI
3dosE           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1ahjB           EKWPFPDAIGHGRNDAGEELFGSDTDGGSVVVDLFEGY--------------------------------
1byiA           ADWVLVEGAGGWFTPLSDTFTFAEQLPVILVVGVKLGCINHAMLTAQVIQHAGLTLAGWANDVTPPGKRH


                         +         .         .         .         .         *         .:210
query           ANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAKVPPPKGDAAAPLQALIIDSWFDNYXXXXXXX
3cb4D           ERVAEEIEDIVGIDATDAVRCSAKTGVGVQDVLERLVRDIPPPEGDPEGPLQALIIDSWFDNYLGVVSLI
3degC           ERVAEEIEDIVGIDATDAVRCSAKTGVGVQDVLERLVRDIPPPEGDPEGPLQALIIDSWFDNYLGVVSLI
2e1rA           AD---ALLEMIVLHLPSPVTAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAF
3dpuA           IENERFPAIENRFHRISCVESIAKSLKSAVLHPDSIYGTPLAPSWI--KVKEKLVEATTAQRYLNRTEVE
1darA           DQAREYHEKTIDLKITPVFLGSALKNKGVQLLLDAVVGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFI
2brvX           TVVRTVRDSMVYNSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFTDNPFKALGGN
2efgA           DNAREYHEKTIDLKITPVFLGSALKNKGVQLLGTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFI
2bm0A           DQAREYHEKTIDLKITPVFLGSALKNKGVQLLLDAVVDEVVEIHPDPNGPLAALAFKIMADPYVGRLTFI
2bm1A           DQAREYHEKTIDLKITPVFLGSALKNKGVQLLLDAVVGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFI
2dy1A           ALLEDLRSTLGPILPIDLPLYEGGKWVGLIDVFHGKAYRYEN----------------------------
2bv3A           --------------------------------GTTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFI
1d8tA           YDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTG
1eftA           LLDLVEMEVRDLGDEVPVIRGSALLALEEMHKNPAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG
1d2eA           MVELEETPIIVGSALCALEQRDPELGLKSVQLLDAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTG
3cw2B           ALSQYRQIKQFTKGTWAIIPVSALHKINIDSLIEGIEEYIKKPVMLVIRSFDVNKPGTQFNELKGGVIGG
1dg1G           YDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTG
2ahoA           ALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGG
2b7cA           SRFQEIVKETSNFKTVPFVPISGWNGDNMIEATTEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVG
1d8tB           YDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTG
2d74A           ALENYRQIKEFIKGTVAENPISALHGANIDVLVKAIEDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDG
1aipA           LLDLVEMEVRDLLNQYEFPGGSALLALEQMHRNPAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG
3chuB           DLVMHGVFP---GSDDPLIRKSVQQAIVDESFTYMHMLAIDRTRELRKIPELVTYRRLRRVLADMPEQWE
1efcA           YDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTG
2c77A           LLDLVEMEVRDPGDEVPVIRGSALLALEQMHRNPAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG
2bvnA           YDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTG
1efuA           YDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTG
2dcuA           ALENYRQIKEFIKGTVAEIPISALHGANIDVLPTPKRDSNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDG
2cnuA           LVARGKVRDIYEVDAGTLLFVATDRISA----YDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDI
1eguA           TVVRTVRDSMVYNSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFTDNPFKALGGN
2bvnB           YDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTG
3chuA           LVMHGVFP----GSDDPLIRKSVQQAIDESFHTYMHMLAIDRTRELRKIPELVTYRRLRRVLADMPEQWE
2cnqA           LVARGKVRDIYEVDAGTLLFVATDRISA----YDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDI
1egaB           DLLPHLQFLASQMNFLDIVPISAETGLNVDTIAAIVRKHLPEATHHFPEDYITDQRFMASEIIREKLMRF
1eg7A           LNLLYELCAKAGA---EVALSWAKGGEGGLELARKVLLESRPSNFHVLYNLDLSIKDKIAKIATEIYGAD
1cjtC           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY-----------
1cs4C           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGD-GRHYCYPHFTCAVDTE
1egaA           DLLPHLQFLASQMNFLDIVPISAETGLNVDTIAAIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLM
2cnvA           LVARGKVRDIYEVDAGTLLFVATDRISA----YDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDI
3ea5C           RKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPN-------------------------
1b23P           LLDLVEMEVRDLLNQYEFPRGSALLALEEMHKNPAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG
1aipE           LLDLVEMEVRDLLNQYEFPGGSALLALEQMHRNPAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG
3bihA           LRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAP
2c78A           LLDLVEMEVRDLGDEVPVIRGSALLALEQMHRNPAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG
3bc1A           AVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRM--------------------------
3bb4A           LSYETFSSKRSDEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAIT---------------
3bigA           LRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAP
1a4xB           EKVMVQLDEVDQNDL-------------------------------------------------------
2b3nA           ----------------------------------------------------------------------
3c14C           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRD----------------------------
3ec5A           EGSAVEITK-------------------------------------------------------------
2cjwA           SVSEGRAAV----VFDKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAY--------------
2dykA           ----LYLGPLYGLGFGDPIPTSSEHARGLEELLEAIWERLP-----------------------------
1aztB           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRI-----------------------
1aym1           DQSFTKWNINLQEMAQIRRKFEMFT---------------------------------------------
2e87A           IKRLEKFVKEKGLNPI---KISALKGTGIDLVKEEIIKTLRPLAEKVAREKIERELRR------------
3bjqE           AKVPRELRDLAHEHECAQIALDPAKYNADHKVKLVGSARWTSPDSDPTKDVETAKEAIADSIGEPNRLLS
3a1sA           KIDRYELQKHLG---IPVVFTSSVTGEGLEELKEKIVEYAQKNTILHRILDYGEKVESEIKKVENFLRDK
1dapA           -----------------------------DDVDVLFLCMGSATDIPEQAPKFAQFACTVYDNHRDIPRHR
1ceeA           ETAEKLARD---LKAVKYVECSALTQKGLKNVFDEAILAALEP---------------------------
1ajeA           TIEKLAKNKQKPITPETAEECSALTQKGLKNVFDEAILAALEPPEP------------------------
1cjuC           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRD----------------------------
2dfkD           ETAEKLARDLKAV---KYVECSALTQKGLKNVFDEAILAALEPSRR------------------------
1an0B           ITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEEPKK------------------------
3bc1E           AVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRM--------------------------
1culC           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDLRISTASGDGRHYCYPHFT---------
1eg7B           LNLLYELCAKAGA---EVALSWAKGGEGGLELARKVLQTLESRPSNFHVLLDLSIKDKIAKIATEIYGAD
2b6hA           VSELTDKLGLQHLRSRTWYATCATQGTGLYDGLDWLSHELS-----------------------------
2byeA           QRAIGPEEEIMQILS----SWFPEEGYMGRIVLK------------------------------------
3c15C           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRI-----------------------
1byuA           RKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPP-------------
2cxxB           EVINFLAEKFEVPLSEIDKVISAKFGDNIERLKNRIFEVIR-----------------------------
1ecrA           KHIIKNLHRDEVLAQLEKRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIARVWYKGDQKQVQHACPTP
3e5hA           MRTIKPEKHLRFCQENGFSFVSAKTGDSVFLCFQKVAAEILGIKLN------------------------
3ea5A           RKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM-------------------
3bfkB           VINDNDATQYAKKEKLAFIETSALEATNVELAFHQLLNEIYNVRQKK-----------------------
3a1vA           MKIDYELQKHLGI---PVVFTSSVTGEGLEELKEKIV---------------------------------
2dfkB           ITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPKSRRCVLL-------------------
1a2kE           KAKSIVFHRKKNLQYY---DISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALA---------------
1a4rA           TIEKLAKNKQKPITPETAEECSALTQKGLKNVFDEAILAALEPPEP------------------------
1cc0A           TRRELAKMKQEPVKPEEGRECSAKTKDGVREVFEMATRAALQARRG------------------------
1byuB           KAKSIVFHRKKNLQYY---DISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPP-------------
2dwqA           ----------------------------------------------------------------------
2aseA           ETAEKLARDLKAVKYV---ECSALTQKGLKNVFDEAILAAL-----------------------------
2c5zA           ----------------------------------------------------------------------
2atxA           ICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTP---------------------------
3bb3A           LSYETFSSKRSDS-----LLKTIRAGSKMRKQEFEDSAIAVYAENSGRCSKNDKDEKALPNGEAWIPNLV
1an0A           ITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEP------------------------
3doeA           SNAIREVLELDSIRSHHWQGCSAVTGENLLPGIDWLLDDISIFTADLEHHHH------------------
1a2kD           RKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALA---------------
2bkuA           KAKSIVFHRKKNLQYY---DISAKSNYNFEKPFLWLARKLIGDPNL------------------------
2bmjA           RVVGDARARALCADMKRCYETCATYGLNVDRVFQEVAQKVVTLRKQ------------------------
2cxxC           EVINFLAEKFEVPLSEIDKVISAKFGDNIERLKNRIFEVIRE----------------------------
2a5fA           PHEIQEKLGLTRIRDRNWYPSCATSGDGLYEGLTWLT---------------------------------
2ahjD           ----------------------------------------------------------------------
3ddcA           ES--RQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
3conA           DT--KQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYR--------------------------
1e0sA           PHEIQEKLGLTRIRDRNWYPSCATSGDGLYEGLTWLTSNY------------------------------
1dpfA           AEGRDMANRIGAF---GYMECSAKTKDGVREVFEMATRAA------------------------------
1cjvC           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEF--------------------------
1c82A           TVVRTVRDSM------------------------------------------------------------
2c5lA           ES--RQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
3e3xA           ----------------------------------------------------------------------
1as3A           KKSPEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNN--------------------------
1aztA           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY-----------
2bjnB           ----------------------------------------------------------------------
2al7A           EKQLIEKMNLSAIQDREICSISCKEKDNIDITLQWLIQHS------------------------------
621pA           TVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
3c5hA           RYIRDAHTFALSKKNLQVVETSARSNVNVDLAFSTLVQLI------------------------------
1a2kC           RKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPP-------------
1c1yA           VGKEQGQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQIN-----------------------------
3d5bF           AARAPEGLNVYDIVRTERLDLDAWE--VFQNRI-------------------------------------
3bfkA           NDNDATQYAKKEKLAFI--ETSALEATNVELAFHQLLNEIYNVR--------------------------
1d5cA           VTYEEGQKAQEYNTFH---ETSAKAGHNIKVLFKKTASKL------------------------------
121pA           -VESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
1cf4A           TIEKLAKNKQKPITPETAEECSALTQKGLKNVFDEAILAALEPPEP------------------------
2dbyA           ----------------------------------------------------------------------
3brwD           EDEEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQIN-----------------------------
3cx7A           QVVSIKDYFLEFEGDPHCLFTTAINTENIRLVFRDVKDTI------------------------------
3eg5A           ETAEKLARDLKAVKYV---ECSALTQRGLKNVFDEAILAAL-----------------------------
3eg5B           GEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYY-----------------------------
1ds6A           TIEKLKEKKLAPITYPQGLECSALTQRGLKTVFDEAIRAVLCPQ--------------------------
2cxxA           EVINFLAEKFEVPLSEIDKVISAKFGDNIERLKNRIFEVIR-----------------------------
3batA           ERIKKELEEQNVTLLEQKNFGSMKQLEDKVEELL---SKNYHLENE-VARLKKLV---------------
3bh6A           ASEIAEGLNLHTIRDRVWQSCSALTGEGVQDGMNWVCKNV------------------------------
1cluA           ES--RQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
3basB           ERIKKELEEVTLLEQKNDLFGSMKQ---LEDKVEELLSKNYHLENE-VARLKKLVGE-------------
3dz8A           VPTEKGQLLAEQLGFDFF-EASAKENISVRQAFERLVDAIC-----------------------------
521pA           AARTVESRQAQDLARSYGIETSAKTRQGVEDAFYTLVREIR-----------------------------
3a1tA           TGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIV---------------------------------
2bmeB           TFLEASRFAQEN--ELMFLETSALTGENVEEAFVQCARKILNKI--------------------------
1doaA           ETAEKLARDLKAVKYV---ECSALTQKGLKNVFDEAILAALEPPEP------------------------
1e96A           TIEKLKEKKLTPITYPQGLECSALTQRGLKTVFDEAIRAV------------------------------
3bh7A           ASEIAEGLNLHTIRDRVWQSCSALTGEGVQDGMNWVCKNV------------------------------
2e9sA           DKRQIEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALL-----------------------------
3batC           ERIKKELEEVTLLEQKNDLFGSMK---QLEDKVEELLSKNYHLENE-VARLKKLVG--------------
3a1uB           TGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIV---------------------------------
1am4D           TIEKLAKNKQKPITPETAEECSALTQRGLKNVFDEAILAA------------------------------
2a5dA           PHEIQEKLGLTRIRDRNWYPSCATSGDGLYEGLTWLTSNY------------------------------
3cbqA           VSLEEGRHLAGTLSCKHI-ETSAALHHNTRELFEGAVRQIRLRR--------------------------
3cwzA           DKRQVSIEEGERKAKELNVMTSAKAGYNVKQLFRRVAAALP-----------------------------
3basA           ERIKKELEEVTLLEQKNDLFGSMKQ---LEDKVEELLSKNYHLENE-VARLKKLVG--------------
3dpbB           VTVTVVEPARITLTYKEGAPITIMDNGNISTSVNFTDAAGLTFTSQDGNNHQFTTKVIGKDSR--DFDIS
3defA           LSYETFSSKRSDSL-----LKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNG-------
2cldX           ES--RQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREI------------------------------
2bnxA           DDFGEVFQIILNTVKDSKA--EPHFLSILQHLLLVRNDYEARP---------------------------
3bbpA           QVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL------------------------------
3cqgB           RTLPEQLLAEKQLNLSAMPTAPQLIGLYICEKALDLLEYIDENINDLKLEILCKALQRDNVSKDSIFVKI
1cxzA           TRRELAKMKQEPVKPEEGRECSAKTKDGVREVFEMATRAAL-----------------------------
2c2hA           ITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAV------------------------------
221pA           TVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
1d1nA           ---------------------------------------------------QAEVRQTFKVSKVGTIAGC
3a1vB           YELQKHLGIPV-------VFTSSVTGEGLEELKEKIVEYAQ-----------------------------
2bmeC           TFLEASRFA--QENELMFLETSALTGENVEEAFVQCARKILNKI--------------------------
1bh2A           PLTICYPEYAGSNTYEEAAFTCSTDTKNVQFVFDAVTDVI------------------------------
2ce2X           ES--RQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
2d7cA           AVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEI------------------------------
2efcB           DARKVTAEDAQTYAQENGLFTSAKTATNVKEIFYEIARRLP-----------------------------
3batB           ERIKKELEEVTLLEQKNDLFGSMKQ---LEDKVEELLSKNYHLENE-VARLKKLVGE-------------
2dpxB           EVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQI------------------------------
3dsnC           -----------------------------VNFTDAAGDPMYTFTSQDGNNHQFTTKVIGKDSRDFDISPK
2ahjB           ----------------------------------------------------------------------
1a2bA           TRRELAKMKQEPVKPEEGRECSAKTKDGVREVFEMATRAAL-----------------------------
3cf6R           ED--ERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ-------------------------------
2bcgY           VVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETT-----------------
2b3mA           ----------------------------------------------------------------------
2bcjQ           DGPQRDAQAAREFILKMFHFTCATDTENIRFVFAAVK---------------------------------
3ch5A           KAKSINLQYY---------DISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPEVVMDPA-------
3a1sB           KIDRYELQKHLGIPVV---FTSSVTGEGLEELKEKIVKNTILHILDYGEKVESEI---------------
2aedA           TY--EEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIY-----------------------------
3c5cB           VTKAEGVALAGRFGCLFFEVSACLDFEHVQHVFHEAVREA------------------------------
2bmeA           EVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES------------------------
1chpD           EVPGSQDSQKKAIRMKDTLRIAYLTEAKVEKLCVWNNKTPH-----------------------------
2a78A           QVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKME------------------------
3efxD           EVPGQKKAIERMKDTL---RIAYLTEAKVEKLCVWNNKTPN-----------------------------
2crvA           ------------------------------------------------------TFTVTEGKKKIPVADC
1azsC           LAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASG--DGRHYCYPHFTCAVDT
1agpA           E--SRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-----------------------------
2bmdA           EVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELD--------------------
2efhB           KVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP-----------------------------
2c2hB           TIERLRDKKLAPITYPQGLECSALTQRGLKTVFDEAIRAV------------------------------
2e9sB           QITIEEGEQRAKELSVMFIETSAKTGYNVKQLFRRVASALL-----------------------------
2clsB           TLMELSHQKQAPISYEQGCEGSAFTSESIHSIFRTASMLC------------------------------
3c5cA           VTKAEGVALAGRFGCLFFEVSACLDFEHVQHVFHEAVREA------------------------------
2clsA           TLMELSHQKQAPISYEQGCEGSAFTSESIHSIFRTASMLC------------------------------
3bjiD           EKKLTPIAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV------------------------------
2dwqB           ----------------------------------------------------------------------
3bfkE           ND--NDATQYAKKEKLAFIETSALEATNVELAFHQLLNEIY-----------------------------
3dosE           ---------------------------------------YLTFTSQDGNNHQFTTKVIGKDSR--DFDIS
3cphA           -------------------ESSAKNDDNVNEIFFTLAKLIQEKI--------------------------
1ahjB           ----------------------------------------------------------------------
1byiA           AEYMTTLTRMIPA---------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXNGTLRPKDKVLLMATGAQHLVEQVGVFSPKSIQRDELTAGQVGFVIAGIKELKAAKVGDTITTMTRR
3cb4D           RIKNGTLRKGDKVKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNP
3degC           RIKNGTLRKGDKVKVMSTGQTYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDIHGAPVGDTLTLARNP
2e1rA           GRVAGTVKSGQKVRIQGPNYVPGKKDDRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTSETA
3dpuA           KICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIY--VLDPHWVTIGVYRIINSSKTKNGHLNTSA
1darA           RVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVI
2brvX           LVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYI-----------DHTNVAYTGAY
2efgA           RVYSGTLTSGSYVYNTTKGRKERVARLLRMHAN---HREEVEELKAGDLGAVVGLKETITGDTLVGEDAP
2bm0A           RVYSGTLTSGSYVYNTTKGRKERVARLLRMHANHREE---VEELKAGDLGAVVGLKETITGDTLVG-EDA
2bm1A           RVYSGTLTSGSYVYNTTKGRKERVARLLRMHAN---HREEVEELKAGDLGAVVGLKETITGDTLVGEDAP
2dy1A           ---------------------------------------------------------------TAKERLQ
2bv3A           RVYSGTLTSGSYVYNTTKGRKERVARLLRMHAN---HREEVEELKAGDLGAVVGLKETITGDTLVGEDAP
1d8tA           RVERGIIKVGEEVEIVGIKETQKST-CTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTI
1eftA           RIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQ--VLAKPG
1d2eA           TLERGILKKGDECEFLGHSKNIRTVVTGIEMFHKSLDRAEAGDNLGALVRGLKR---EDLRRGLVMAKPG
3cw2B           SIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGD---------EEFKEAKPGGLVAIGTYL
1dg1G           RVERGIIKVGEEVEIVGIKETQKSTCTGVE-MFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTI
2ahoA           SIIQGLFKVDQEIKVLPGLRVVSYEPIFTK--------------ISSIRFGDEEFKEAKPGGLVAIGTY-
2b7cA           RVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQ---LEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKND
1d8tB           RVERGIIKVGEEVEIVGIKETQKSTCTGVE-MFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKP--G
2d74A           SIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTGGQFVEEAYPGGLVGIGTKLDPYLTKGDLMAGNVVG
1aipA           RIERGKVKVGDEVEIVGLAPETRRTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLAKPGS-
3chuB           RDIAVLVWGAVAETCINALLALLARDATIQPMHSLITTLHLRDETAHGSIVVEVVRELYARMFAEQDLSA
1efcA           RVERGIIKVGEEVEIVGIKETQKST-CTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTI
2c77A           RIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVER----------
2bvnA           RVERGIIKVGEEVEIVGIKETQKSTCTGVE-MFRKLLDEGRAGENVGVLLRGIKREEIERGQVL------
1efuA           RVERGIIKVGEEVEIVGIKETQKSTCTGVEMFR-KLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTI
2dcuA           SIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQEAYPGGLVGIGTKLDPYLTKGDLMAGNVVG
2cnuA           APGKTIFDYLPAKLSEPKYKTQLEDRSLLV--HKHKLIPLEVIVRGY-ITGSAWKEYVKTGTVHGLK---
1eguA           LVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDHTNV-----------AYTGAY
2bvnB           RVERGIIKVGEEVEIVGIKETQKST-CTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQV-------
3chuA           RDIAVLVWGAVAETCINALLALLARDATIQPMHSLITTLHLRDETAHGSIVVEVQQRRALVRCLPIALEA
2cnqA           APGKTIFDYLPAKLSEPKYKTQLEDRSLLV--HKHKLIPLEVIVRGY-ITGSAWKEYVKTGTVHGLKQPQ
1egaB           LGAELPYSVTVEIERFVSNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGI---EARKDMQEMFEAP
1eg7A           GVNYTAEADKAIQRYESLGYGNLPVVMAKTQYSFSDDMTKLGRPRNFTITVREVRLSAGGRLIVPITGAI
1cjtC           ----------------------------------------------------------------------
1cs4C           NIRRVFNDCRDIIQ--------------------------------------------------------
1egaA           RFLGAELPYSVTV-EIERFVSNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMF--E
2cnvA           APGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKH---KLIPLEVIVRGYITGSAWKEYVKTGT------VH
3ea5C           ----------------------------------------------------------------------
1b23P           RIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVERGQVLATKFEA
1aipE           RIERGKVKVGDEVEIVGLAPETRRTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQV-------
3bihA           EGVVRHDVKNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIAT
2c78A           RIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQV-------
3bc1A           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3bigA           EGVVSADVKNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGI-----TKGDLLEGI---
1a4xB           ----------------------------------------------------------------------
2b3nA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3bjqE           RKALSACKYHPKLIERVKY-----TRAESITIDLKALWEVEEIVVGTARV-ATDSFGDVWGPDVWLGYVS
3a1sA           KLRINPRYFALKYLSG--DPEFYSEGVKLGLPELSEEERIG---YRLLIAKRKREYVENVVKEA------
1dapA           QVMNEAATAAGNVALVSTGWDPGMFSINRTFWGPGLSQGHSDALRRIPGVQKAVQYTLPSEDALEKARRG
1ceeA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1eg7B           GVNYTAEADKAIQRYESLGYGNLPVVMAKTQYSFSDDMTKLGRPRNFTITVREVRLSAGGRLIVPITGAI
2b6hA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ecrA           LIALINRDNGAGVPDVGELLNYDANVQHRYKPQAQPLRLIIPRLHLYV----------------------
3e5hA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2c5zA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3bb3A           KAITDVATNQRKAIHV------------------------------------------------------
1an0A           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3conA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3e3xA           ----------------------------------------------------------------------
1as3A           ----------------------------------------------------------------------
1aztA           ----------------------------------------------------------------------
2bjnB           --------------------LLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTAR
2al7A           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3c5hA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1c1yA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3brwD           ----------------------------------------------------------------------
3cx7A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3basB           ----------------------------------------------------------------------
3dz8A           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3batC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3basA           ----------------------------------------------------------------------
3dpbB           PKVNGENLVGDDVVLATGSQDFFVRSIGSKGG---KLAAGKYTDVTVTVS--------------------
3defA           ---EAWIPNLVKAITDVA----------------------------------------------------
2cldX           ----------------------------------------------------------------------
2bnxA           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3cqgB           LLPEVKDLLQADFEFVL-----------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
1d1nA           YVTDGKITRDSKVRLIRQGIVVYEGEIDSLKRYKDDVREVAQGYCGLTIKNFNDI---KEGDVIEA----
3a1vB           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
3batB           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
3dsnC           VN--GENLVGDDVVLATGSQDFFVRSIGSKGG---KLAAGKYTDVTVTVS--------------------
2ahjB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
3cf6R           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
2b3mA           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aedA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
2crvA           RVQKGQLERHKKFKLIRNGQVIWKGSLTSLKHHKDDISVIKTGMCGLSLDEEKV--EFKPGDQVENKVPT
1azsC           ENIRRVFNDCRDIIQRMHLRQY------------------------------------------------
1agpA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
2e9sB           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
2clsA           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
3dosE           PKVNGENLVGDDVVLATGSQDFFVRSIGSK---GGKLAAGKYTDVTVTVS--------------------
3cphA           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AEAPLPGFKEVKPQVFAGLYPVESNQYEALRESLEKLRLNDASLQFEPEVSQAXXXXXXXXXXXXXHMEI
3cb4D           AEKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPESSSALGFGFRCGFLGLLHMEI
3degC           AEKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPESSSALGFGFRCGFLGLLHMEI
2e1rA           HNMKVMKFS-VSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGEL----HLEI
3dpuA           LGYILNEEKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLTQIITEGEPLRFIMKYDYLPSTIIPR
1darA           LEEEDPTFRVSTQTIISGMGEPVDVEGKFIRQTGGRGQYGHVKIKVEPGSGFEFVNAIVGGVIPKEYIPA
2brvX           GNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSF--------------------APLLVNGELMDM
2efgA           RVILESVGKP-QVAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRFEFVNAIVGGVIPKEYIPA
2bm0A           PRVILESIEVPEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPE---TGQTIISGMGELHLEI
2bm1A           RVILESIEV-PEPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTHPE---TGQTIISGMGELHLEI
2dy1A           DYGVEVEFSVPKVPYRETIKKVAEGQGKYKKQTGGHGQYGDVWLRLEPASEYGFEWRITGGVIPSKYQEA
2bv3A           RVILESIEVVAIEPSPTFSVSTHPETGSTIRQTGGRGQYGHVKIKVEPGSGFEFVNAIVGGVIPKEYIPA
1d8tA           --KPHTKFESEVYILSKDEGGRHTPFF-------------------------------------------
1eftA           SITPHTKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVRLPQGVEMVMPGDNVTFTVELIKPV
1d2eA           SIQPHQKVEAQVYILTKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPGKELEDLKLTLILRQPMILEK
3cw2B           DPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDE
1dg1G           KPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG-----------------------------
2ahoA           -LDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLK-VDPIRAKETLMLSVGSSTTLG
2b7cA           PPKGCASFNATVIVLNHPGQI-------------------------------------------------
1d8tB           TIKPHTKFESEVYILSKDEGG-------------------------------------------------
2d74A           KPGKLPPVWT------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
3chuB           LLLELNAAGIVGDLRSTAGGTRLVRDFSGARKMVEQLGLDDA----------------------------
1efcA           KPHT------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1efuA           KPHT------------------------------------------------------------------
2dcuA           KPGKLPPVW-------------------------------------------------------------
2cnuA           QPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAE---LAVKLYSKCKDYAKEKGIII
1eguA           GNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDMSRGRSISRANSEGHVAAVEV
2bvnB           ----------------------------------------------------------------------
3chuA           EQDLSALLLELNAAGIRGAEEIVGDLRLVRDF--SGARKMVEQLGLDD----------------------
2cnqA           ---GLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAE---LAVKLYSKCKDYAKEKGIII
1egaB           VHLELSGWAD-DERALRSL---------------------------------------------------
1eg7A           MTMPGLPKRAACNID-------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1egaA           APVHLELWVKVKSGWAD-----------------------------------------------------
2cnvA           GLKQPQGLKESQEFPEPIFTPSTKDENISPAQAAELVGEDLSRRVAEL-----AVKLYSKCKDYAKEKGI
3ea5C           ----------------------------------------------------------------------
1b23P           SVYILKKEEGGRHTGFFTGYRPQFYFRTTDVTGVVRLPQGNVTFTVELIKPVA-----------------
1aipE           ----------------------------------------------------------------------
3bihA           TETLLIRGKSRTIRIQSIHY--------------------------------------------------
2c78A           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3bigA           --SRKGNIATTETLLIRGKSTIRRIQSI------------------------------------------
1a4xB           ----------------------------------------------------------------------
2b3nA           ------------------------------------------------------------------KMMS
3c14C           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3bjqE           DNPDPSVEEPSFGYTYQIGHPLVEVPYWDNNAKSWIYGVSDDNT--------------------------
3a1sA           ----------------------------------------------------------------------
1dapA           EAGDLTGKQTHKRQCF---VVADAADHERIENDIRTM--PDYFVGYEVEVNFIDEATFDSEHTGMPHGGH
1ceeA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1eg7B           MTMPGLPKRAACNID-------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2c5zA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3conA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3e3xA           ---PTVTTFQVNTSPFAGEGFVTSRN---ILERLEKELVHNVALRVEQTDDPDKFRVSGRGEL---HLSI
1as3A           ----------------------------------------------------------------------
1aztA           ----------------------------------------------------------------------
2bjnB           FKDELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTHASKYLAFTCGLIRGGLSNLGIKS
2al7A           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3c5hA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1c1yA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3brwD           ----------------------------------------------------------------------
3cx7A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3basB           ----------------------------------------------------------------------
3dz8A           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3batC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3basA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2cldX           ----------------------------------------------------------------------
2bnxA           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
3batB           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
3cf6R           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
2b3mA           ------------------------------------------------------------------KMMS
2bcjQ           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aedA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
2crvA           KTSWDPGFS-------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
2e9sB           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
2clsA           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VQERLEREFDMDLITTAPTVVYQVQQRDGTVLTVENPAKMPDPSKIEAILEPIVTVNLYMPQDYVGSVMT
3cb4D           IQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELREPIAECHMLLPQAYLGNVIT
3degC           IQERLEREYDLDLITTAPTVVYEVETTSREVIYVDSPSKLPAVNNIYELREPIAECHMLLPQAYLGNVIT
2e1rA           CLQDLEHDAGVPLKISPPVVAYRETVESESSQTALSKSPNKHNRIYLKAEPIDEEVSLAIENGIINPRDD
3dpuA           LMIA-MQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPR-------CKREYLSIIWY
1darA           VQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAILEPIMRVEVTTPEEYMGDVIG
2brvX           SRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQ-------------RLQSLVKTIVQSDSYYDVFK
2efgA           VQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAILEPIMRVEVTTPEEYMGDVIG
2bm0A           IVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFIRQTGGR-------GQYGHVKIKVEPLPRGSGFE
2bm1A           IVDRLKREFKVDANVGKPQVAYRETITKPVDVEGKFI-------RQTGGRGQYGHVKIKVEPLPRGSGFE
2dy1A           IEEGIKEAAKKGVLAGFPVMGFKAIVYNGSYHEVDSSDLAFQIAASLALLEPIYRLKVLAPQERVGDVLS
2bv3A           VQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAILEPIMRVEVTTPEEYMGDVIG
1d8tA           ----------------------------------------------------------------------
1eftA           ALEEGLR---------------------------------------------------------------
1d2eA           GQRFTLRDGNRTIGTGLVTDTPAMTEEDKN----------------------------------------
3cw2B           IEVELRRPVAVWSNNIRTVISRQIAGRWRMI---------------------------------------
1dg1G           ----------------------------------------------------------------------
2ahoA           IVTSVKKDE-IEVELRRPVAVWSNNIR-------------------------------------------
2b7cA           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2cnuA           A--DTKFEFGIDEKTNEIILVDEVLTPDSSRF-WNGASYKVGESQDSYDKQFLGVNGVKMPQDIVDRTRE
1eguA           LRGIHRIADEGETKQRLQSLVKTIVQSDSYYDVFKNLKTYKDISLMQSLDAGVASVPRTSYLSAFNKMDK
2bvnB           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2cnqA           A--DTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVFLRDWLTANKLNGV-NGVKMPQDIVDRTRA
1egaB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
2cnvA           IIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGE-SQDSYDKQFLRDWLTANKLNGVN-GVK
3ea5C           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3bigA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
2b3nA           LLEEMKGIYSKKGGKVKPFEKFEGELKEGYRFEYEKKLCEIDVAMFGLISGDL---NPVHFDEDFASKTR
3c14C           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1dapA           VITTGDTEYIL-KLDRNPDFTASSQIAFGRAAHRMKQQGQSGAFTVLEV--APYLLSPENLDDLIARDV-
1ceeA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2c5zA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3conA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3e3xA           LIENRREGFELAVSRPEVIIEEDGQL-------------------------EPFETVTIDVEEHQGGIEN
1as3A           ----------------------------------------------------------------------
1aztA           ----------------------------------------------------------------------
2bjnB           IVT--------AEVSSMPACKFQVMIQ-------------------------------------------
2al7A           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3c5hA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1c1yA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3brwD           ----------------------------------------------------------------------
3cx7A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3basB           ----------------------------------------------------------------------
3dz8A           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3batC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3basA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2cldX           ----------------------------------------------------------------------
2bnxA           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
3batB           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
3cf6R           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
2b3mA           LLEEMKGIYSKKGGKVKPFEKFEGELKEGYRFEYEKKLCEIDVAMFGLDLNPVRVVHGMLTTSLVSAAVA
2bcjQ           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aedA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
2e9sB           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
2clsA           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYRQSDVVKVDILINSD
3cb4D           LCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDMVRVDVLINGE
3degC           LCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASDMVRVDVLINGE
2e1rA           FKARARIMADDYGWDVTDRKIWCFGPDGNGPNLVIDQTKAVQYLHEIKDSVVAAFQWATKPIFGEEMRSV
3dpuA           EIKKINANFTNLDVK----EFIPLPGHPDELVEYKELLGLEKM----GRDRYVSGKLEKVFSVSKMLD--
1darA           DLNARRGQILGMEPRGNAQVIRAFVPLAEM-FGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI---
2brvX           NLKTYKDISLMQSLLSDAGVASVPRTSYLSAFNKMDKTAGFGFGLSLFSSRTLNYEH---MNKENKRGWY
2efgA           DLNARRGQILGMEPRGNAQVIRAFVPLAEMF-GYATDLRSKTQGRGSFVMFFDHYQE---VPKQVQE---
2bm0A           FVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMLEPIMRVEVTTPEE
2bm1A           FVNAIVGGVIPKEYIPAVQKTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEE
2dy1A           DLQARRGRILGMEQEGALSVVHAEVPLAEVL-EYYKALPGLTGGAGAYTLEFSHYAEVPPHLAQRIVQER
2bv3A           DLNARRGQILGMEPRGNAQVIRAFVPLAEM-FGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI---
1d8tA           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2cnuA           AYETLTGSKW------------------------------------------------------------
1eguA           TAMYNAEKGFGFGLSLSSRTLNYEHMNKENKRGWYTSDGMFYLYNGDLSHYSDGY---------------
2bvnB           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2cnqA           KY--------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
2cnvA           MPQDIVDRT-------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3bigA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
2b3nA           FGGRVVHGMLTTSLVSAAARLPGTVVLLEQSFRY------------------------------------
3c14C           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2c5zA           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3conA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3e3xA           IGL-----RGELDAPDGKGRVRDFIPSRGLIG--FQTEFTLTSGSGLLYHTFDHYGPHGQRVNGVLIANA
1as3A           ----------------------------------------------------------------------
1aztA           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3c5hA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1c1yA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3brwD           ----------------------------------------------------------------------
3cx7A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3basB           ----------------------------------------------------------------------
3dz8A           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3batC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3basA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2cldX           ----------------------------------------------------------------------
2bnxA           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
3batB           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
3cf6R           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
2b3mA           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aedA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
2e9sB           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
2clsA           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISR
3cb4D           RVDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYG-----
3degC           RVDALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQL---------------
2e1rA           RVNILDVTLHADAIHRGGGQIIPTMRR-ATYAGFLLADPKIQEPVFLVEIQCPE---QAVGGIYSVLNKK
3dpuA           ----------------------------------------------------------------------
1darA           ----------------------------------------------------------------------
2brvX           TSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKVLPSAFVGTSKLDDANATATM---
2efgA           ----------------------------------------------------------------------
2bm0A           YMGDVIGDLNA----RRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQG----------------
2bm1A           YMGDVIGDLNA----RRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQG----------------
2dy1A           AQEG------------------------------------------------------------------
2bv3A           ----------------------------------------------------------------------
1d8tA           ----------------------------------------------------------------------
1eftA           ----------------------------------------------------------------------
1d2eA           ----------------------------------------------------------------------
3cw2B           ----------------------------------------------------------------------
1dg1G           ----------------------------------------------------------------------
2ahoA           ----------------------------------------------------------------------
2b7cA           ----------------------------------------------------------------------
1d8tB           ----------------------------------------------------------------------
2d74A           ----------------------------------------------------------------------
1aipA           ----------------------------------------------------------------------
3chuB           ----------------------------------------------------------------------
1efcA           ----------------------------------------------------------------------
2c77A           ----------------------------------------------------------------------
2bvnA           ----------------------------------------------------------------------
1efuA           ----------------------------------------------------------------------
2dcuA           ----------------------------------------------------------------------
2cnuA           ----------------------------------------------------------------------
1eguA           ----------------------------------------------------------------------
2bvnB           ----------------------------------------------------------------------
3chuA           ----------------------------------------------------------------------
2cnqA           ----------------------------------------------------------------------
1egaB           ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
1egaA           ----------------------------------------------------------------------
2cnvA           ----------------------------------------------------------------------
3ea5C           ----------------------------------------------------------------------
1b23P           ----------------------------------------------------------------------
1aipE           ----------------------------------------------------------------------
3bihA           ----------------------------------------------------------------------
2c78A           ----------------------------------------------------------------------
3bc1A           ----------------------------------------------------------------------
3bb4A           ----------------------------------------------------------------------
3bigA           ----------------------------------------------------------------------
1a4xB           ----------------------------------------------------------------------
2b3nA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3ec5A           ----------------------------------------------------------------------
2cjwA           ----------------------------------------------------------------------
2dykA           ----------------------------------------------------------------------
1aztB           ----------------------------------------------------------------------
1aym1           ----------------------------------------------------------------------
2e87A           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3a1sA           ----------------------------------------------------------------------
1dapA           ----------------------------------------------------------------------
1ceeA           ----------------------------------------------------------------------
1ajeA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
2dfkD           ----------------------------------------------------------------------
1an0B           ----------------------------------------------------------------------
3bc1E           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2b6hA           ----------------------------------------------------------------------
2byeA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
1byuA           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1ecrA           ----------------------------------------------------------------------
3e5hA           ----------------------------------------------------------------------
3ea5A           ----------------------------------------------------------------------
3bfkB           ----------------------------------------------------------------------
3a1vA           ----------------------------------------------------------------------
2dfkB           ----------------------------------------------------------------------
1a2kE           ----------------------------------------------------------------------
1a4rA           ----------------------------------------------------------------------
1cc0A           ----------------------------------------------------------------------
1byuB           ----------------------------------------------------------------------
2dwqA           ----------------------------------------------------------------------
2aseA           ----------------------------------------------------------------------
2c5zA           -----------SQSQRLEHNWNKFFASFVPNLIKKNPQSKQFD-----HENIKQCAKDIVKILTTKELSS
2atxA           ----------------------------------------------------------------------
3bb3A           ----------------------------------------------------------------------
1an0A           ----------------------------------------------------------------------
3doeA           ----------------------------------------------------------------------
1a2kD           ----------------------------------------------------------------------
2bkuA           ----------------------------------------------------------------------
2bmjA           ----------------------------------------------------------------------
2cxxC           ----------------------------------------------------------------------
2a5fA           ----------------------------------------------------------------------
2ahjD           ----------------------------------------------------------------------
3ddcA           ----------------------------------------------------------------------
3conA           ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1dpfA           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1c82A           ----------------------------------------------------------------------
2c5lA           ----------------------------------------------------------------------
3e3xA           AGKALTNALF--NLQERGR---------------------------------------------------
1as3A           ----------------------------------------------------------------------
1aztA           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2al7A           ----------------------------------------------------------------------
621pA           ----------------------------------------------------------------------
3c5hA           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1c1yA           ----------------------------------------------------------------------
3d5bF           ----------------------------------------------------------------------
3bfkA           ----------------------------------------------------------------------
1d5cA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1cf4A           ----------------------------------------------------------------------
2dbyA           ----------------------------------------------------------------------
3brwD           ----------------------------------------------------------------------
3cx7A           ----------------------------------------------------------------------
3eg5A           ----------------------------------------------------------------------
3eg5B           ----------------------------------------------------------------------
1ds6A           ----------------------------------------------------------------------
2cxxA           ----------------------------------------------------------------------
3batA           ----------------------------------------------------------------------
3bh6A           ----------------------------------------------------------------------
1cluA           ----------------------------------------------------------------------
3basB           ----------------------------------------------------------------------
3dz8A           ----------------------------------------------------------------------
521pA           ----------------------------------------------------------------------
3a1tA           ----------------------------------------------------------------------
2bmeB           ----------------------------------------------------------------------
1doaA           ----------------------------------------------------------------------
1e96A           ----------------------------------------------------------------------
3bh7A           ----------------------------------------------------------------------
2e9sA           ----------------------------------------------------------------------
3batC           ----------------------------------------------------------------------
3a1uB           ----------------------------------------------------------------------
1am4D           ----------------------------------------------------------------------
2a5dA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
3cwzA           ----------------------------------------------------------------------
3basA           ----------------------------------------------------------------------
3dpbB           ----------------------------------------------------------------------
3defA           ----------------------------------------------------------------------
2cldX           ----------------------------------------------------------------------
2bnxA           ----------------------------------------------------------------------
3bbpA           ----------------------------------------------------------------------
3cqgB           ----------------------------------------------------------------------
1cxzA           ----------------------------------------------------------------------
2c2hA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
3a1vB           ----------------------------------------------------------------------
2bmeC           ----------------------------------------------------------------------
1bh2A           ----------------------------------------------------------------------
2ce2X           ----------------------------------------------------------------------
2d7cA           ----------------------------------------------------------------------
2efcB           ----------------------------------------------------------------------
3batB           ----------------------------------------------------------------------
2dpxB           ----------------------------------------------------------------------
3dsnC           ----------------------------------------------------------------------
2ahjB           ----------------------------------------------------------------------
1a2bA           ----------------------------------------------------------------------
3cf6R           ----------------------------------------------------------------------
2bcgY           ----------------------------------------------------------------------
2b3mA           ----------------------------------------------------------------------
2bcjQ           ----------------------------------------------------------------------
3ch5A           ----------------------------------------------------------------------
3a1sB           ----------------------------------------------------------------------
2aedA           ----------------------------------------------------------------------
3c5cB           ----------------------------------------------------------------------
2bmeA           ----------------------------------------------------------------------
1chpD           ----------------------------------------------------------------------
2a78A           ----------------------------------------------------------------------
3efxD           ----------------------------------------------------------------------
2crvA           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
1agpA           ----------------------------------------------------------------------
2bmdA           ----------------------------------------------------------------------
2efhB           ----------------------------------------------------------------------
2c2hB           ----------------------------------------------------------------------
2e9sB           ----------------------------------------------------------------------
2clsB           ----------------------------------------------------------------------
3c5cA           ----------------------------------------------------------------------
2clsA           ----------------------------------------------------------------------
3bjiD           ----------------------------------------------------------------------
2dwqB           ----------------------------------------------------------------------
3bfkE           ----------------------------------------------------------------------
3dosE           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1ahjB           ----------------------------------------------------------------------
1byiA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXRMKQVGTVEIPQEAFLAILQVxxx
3cb4D           -------------------------------------
3degC           -------------------------------------
2e1rA           RGQVVSEEQRPGTPLFTV-KAYLPVNES---------
3dpuA           -------------------------------------
1darA           -------------------------------------
2brvX           ---DFTNWNQTLTAHKSWFMLKDKIAFLGSNIQN---
2efgA           -------------------------------------
2bm0A           -------------------------------------
2bm1A           -------------------------------------
2dy1A           -------------------------------------
2bv3A           -------------------------------------
1d8tA           -------------------------------------
1eftA           -------------------------------------
1d2eA           -------------------------------------
3cw2B           -------------------------------------
1dg1G           -------------------------------------
2ahoA           -------------------------------------
2b7cA           -------------------------------------
1d8tB           -------------------------------------
2d74A           -------------------------------------
1aipA           -------------------------------------
3chuB           -------------------------------------
1efcA           -------------------------------------
2c77A           -------------------------------------
2bvnA           -------------------------------------
1efuA           -------------------------------------
2dcuA           -------------------------------------
2cnuA           -------------------------------------
1eguA           -------------------------------------
2bvnB           -------------------------------------
3chuA           -------------------------------------
2cnqA           -------------------------------------
1egaB           -------------------------------------
1eg7A           -------------------------------------
1cjtC           -------------------------------------
1cs4C           -------------------------------------
1egaA           -------------------------------------
2cnvA           -------------------------------------
3ea5C           -------------------------------------
1b23P           -------------------------------------
1aipE           -------------------------------------
3bihA           -------------------------------------
2c78A           -------------------------------------
3bc1A           -------------------------------------
3bb4A           -------------------------------------
3bigA           -------------------------------------
1a4xB           -------------------------------------
2b3nA           -------------------------------------
3c14C           -------------------------------------
3ec5A           -------------------------------------
2cjwA           -------------------------------------
2dykA           -------------------------------------
1aztB           -------------------------------------
1aym1           -------------------------------------
2e87A           -------------------------------------
3bjqE           -------------------------------------
3a1sA           -------------------------------------
1dapA           -------------------------------------
1ceeA           -------------------------------------
1ajeA           -------------------------------------
1cjuC           -------------------------------------
2dfkD           -------------------------------------
1an0B           -------------------------------------
3bc1E           -------------------------------------
1culC           -------------------------------------
1eg7B           -------------------------------------
2b6hA           -------------------------------------
2byeA           -------------------------------------
3c15C           -------------------------------------
1byuA           -------------------------------------
2cxxB           -------------------------------------
1ecrA           -------------------------------------
3e5hA           -------------------------------------
3ea5A           -------------------------------------
3bfkB           -------------------------------------
3a1vA           -------------------------------------
2dfkB           -------------------------------------
1a2kE           -------------------------------------
1a4rA           -------------------------------------
1cc0A           -------------------------------------
1byuB           -------------------------------------
2dwqA           -------------------------------------
2aseA           -------------------------------------
2c5zA           RAPPDDLTKGKRHKVKEFINSYM--------------
2atxA           -------------------------------------
3bb3A           -------------------------------------
1an0A           -------------------------------------
3doeA           -------------------------------------
1a2kD           -------------------------------------
2bkuA           -------------------------------------
2bmjA           -------------------------------------
2cxxC           -------------------------------------
2a5fA           -------------------------------------
2ahjD           -------------------------------------
3ddcA           -------------------------------------
3conA           -------------------------------------
1e0sA           -------------------------------------
1dpfA           -------------------------------------
1cjvC           -------------------------------------
1c82A           -------------------------------------
2c5lA           -------------------------------------
3e3xA           -------------------------------------
1as3A           -------------------------------------
1aztA           -------------------------------------
2bjnB           -------------------------------------
2al7A           -------------------------------------
621pA           -------------------------------------
3c5hA           -------------------------------------
1a2kC           -------------------------------------
1c1yA           -------------------------------------
3d5bF           -------------------------------------
3bfkA           -------------------------------------
1d5cA           -------------------------------------
121pA           -------------------------------------
1cf4A           -------------------------------------
2dbyA           -------------------------------------
3brwD           -------------------------------------
3cx7A           -------------------------------------
3eg5A           -------------------------------------
3eg5B           -------------------------------------
1ds6A           -------------------------------------
2cxxA           -------------------------------------
3batA           -------------------------------------
3bh6A           -------------------------------------
1cluA           -------------------------------------
3basB           -------------------------------------
3dz8A           -------------------------------------
521pA           -------------------------------------
3a1tA           -------------------------------------
2bmeB           -------------------------------------
1doaA           -------------------------------------
1e96A           -------------------------------------
3bh7A           -------------------------------------
2e9sA           -------------------------------------
3batC           -------------------------------------
3a1uB           -------------------------------------
1am4D           -------------------------------------
2a5dA           -------------------------------------
3cbqA           -------------------------------------
3cwzA           -------------------------------------
3basA           -------------------------------------
3dpbB           -------------------------------------
3defA           -------------------------------------
2cldX           -------------------------------------
2bnxA           -------------------------------------
3bbpA           -------------------------------------
3cqgB           -------------------------------------
1cxzA           -------------------------------------
2c2hA           -------------------------------------
221pA           -------------------------------------
1d1nA           -------------------------------------
3a1vB           -------------------------------------
2bmeC           -------------------------------------
1bh2A           -------------------------------------
2ce2X           -------------------------------------
2d7cA           -------------------------------------
2efcB           -------------------------------------
3batB           -------------------------------------
2dpxB           -------------------------------------
3dsnC           -------------------------------------
2ahjB           -------------------------------------
1a2bA           -------------------------------------
3cf6R           -------------------------------------
2bcgY           -------------------------------------
2b3mA           -------------------------------------
2bcjQ           -------------------------------------
3ch5A           -------------------------------------
3a1sB           -------------------------------------
2aedA           -------------------------------------
3c5cB           -------------------------------------
2bmeA           -------------------------------------
1chpD           -------------------------------------
2a78A           -------------------------------------
3efxD           -------------------------------------
2crvA           -------------------------------------
1azsC           -------------------------------------
1agpA           -------------------------------------
2bmdA           -------------------------------------
2efhB           -------------------------------------
2c2hB           -------------------------------------
2e9sB           -------------------------------------
2clsB           -------------------------------------
3c5cA           -------------------------------------
2clsA           -------------------------------------
3bjiD           -------------------------------------
2dwqB           -------------------------------------
3bfkE           -------------------------------------
3dosE           -------------------------------------
3cphA           -------------------------------------
1ahjB           -------------------------------------
1byiA           -------------------------------------