[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09433.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bisB.bssp"
#ERROR : Can't open dsspfile "1c6vB.bssp"
#ERROR : Can't open dsspfile "1bl3B.bssp"
#ERROR : Can't open dsspfile "1biuA.bssp"
#ERROR : Can't open dsspfile "1c6vA.bssp"
#ERROR : Can't open dsspfile "1bizA.bssp"
#ERROR : Can't open dsspfile "1bi4C.bssp"
#ERROR : Can't open dsspfile "2b4jA.bssp"
#ERROR : Can't open dsspfile "1b9dA.bssp"
#ERROR : Can't open dsspfile "1b92A.bssp"

## Summary of PDB Search
:278
    3e-07  14%  1bisB  [c.55.3] HIV-1 INTEGRASE
    8e-06  12%  1c6vB  [c.55.3] PROTEIN (SIV INTEGRASE)
    1e-05  11%  1bl3B  [c.55.3] INTEGRASE
    4e-05  15%  1biuA  [c.55.3] HIV-1 INTEGRASE
    6e-05  10%  1c6vA  [c.55.3] PROTEIN (SIV INTEGRASE)
    2e-04  13%  1bizA  [c.55.3] HIV-1 INTEGRASE
    3e-04  15%  1bi4C  [c.55.3] INTEGRASE
    6e-04  11%  2b4jA  [x.x.x] INTEGRASE (IN)
    6e-04  10%  1b9dA  [c.55.3] PROTEIN (INTEGRASE)
    8e-04  10%  1b92A  [c.55.3] PROTEIN (INTEGRASE)
:278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1bisB           ----------------------------------------------------------------------
1c6vB           ----------------------------------------------------------------------
1bl3B           ----------------------------------------------------------------------
1biuA           ----------------------------------------------------------------------
1c6vA           ----------------------------------------------------------------------
1bizA           ----------------------------------------------------------------------
1bi4C           ----------------------------------------------------------------------
2b4jA           ----------------------------------------------------------------------
1b9dA           ----------------------------------------------------------------------
1b92A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDRSNTRWCSDGFEFRCDDGSPLRVTFALDCHD
1bisB           -----------------------------------------PGIWQLDCTH-----LEGKVILVAVHVAS
1c6vB           --------------------------------------NSDLGTWQMDCTHLEGK-----IVIVAVHVAS
1bl3B           ----------------------------------------SPGIWQLDCTHLEGK-----VILVAVHVAS
1biuA           ----------------------------------------------------------------------
1c6vA           --------------------------------------NSDLGTWQMDCTHLEGK-----IVIVAVHVAS
1bizA           -------------------------------------VDSSPGIWQLDCTHLE-----GKVILVAVHVAS
1bi4C           -------------------------------------VDCSPGIWQLDCTH-----LEGKVILVAVHVAS
2b4jA           ----------------------------------------SPGIWQLDCTHLEGK-----VILVAVHVAS
1b9dA           ----------------------------------------SPGIWQLDCTHL-----EGKVILVAVHVAS
1b92A           -----------------------------------------PGIWQLDHLEGKV-------ILVAVHVAS


                         +         .         .         .         .         *         .:210
query           REAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWLSDNGSAYIDHRTRSFARELGLEPLTTPV
1bisB           GYIEAEVIPAETGQETAYF---------LLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWAGIKQEFGIP
1c6vB           GFI--EAEVIPQETGR-------QTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGEA
1bl3B           GYIEAEV---------IPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFVIE
1biuA           -------------------------------------------DNGSNFTSTTVKAACEWGGIKQEFGQG
1c6vA           GFIEAEVIPQETGR---------QTALFLLKLAGRWPITHLHTDNGANFASQEVKMVAWWAGIEHTFGEA
1bizA           GYIEAEVIPAE-------TGQETAYFLLKLAGRWPVKTVHT--DNGSNFTSTTVKAACWWAGIKQEFGGV
1bi4C           GYIEAEVIPAETGQ---------ETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIP
2b4jA           GYIEAEVIPAETGQETAYFLLKLAGRWPVK---------TVHTDNGSNFTSTTVKAACWWAGIKQEFVIE
1b9dA           GYIEAEVIPAETG----QETAYFLLKLAGRWPVKT-----VHTDNGSNFTSTTVKAACWWAGIKQEFGGV
1b92A           GYIEAEV---------IPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGAV


                         .         .         .         +         .         .         .:280
query           RSPQSNGMAESFVKTMKRDYIAFMNKPDVPTALSQLTVAFEQYNDWHPHKALKYRSPREFRxxxxxxx
1bisB           YNPQSQGVIESMNKELKK-IIGQVRDQAEHLKTAVQMAVF--IHNKKRKGGIGGYSAGERI-------
1c6vB           MNHHLKNQIDRIREQANSVETIVLM-------------AVHCMN-HKRRGGIGDMTPAERL-------
1bl3B           SMNKELKKIIGQVRDQAEHLKTAVQM------------AVFIHN-HKRKGGIGGYSAGE---------
1biuA           VIESMNKELKKIIGQV--RDQAEHLKTAVQMA--------VFIHNKKRKGGIGGYSAGERI-------
1c6vA           MNHHLKNQIDRIREQANSVETIVLM-------------AVHCMN-HKRRGGIGDMTPAERL-------
1bizA           IESMNKELKKIIGQVRDQAEHLKTA----------VQMAVFIHN-KKRKGGIGGYSAGER--------
1bi4C           YNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQM---AVFIHNHKRKGGIGGYSAGERI-------
2b4jA           SMNKELKKIIGQVRDQAEHLKTAVQM------------AVFIHNKKSAGERIVDIIATD---------
1b9dA           IESMNKELKKIIGQVRDQAEHLKT---AVQMAVFIHN--KKRKGGYSAGERIVDIIATDIQ-------
1b92A           IESMNKELKKIIGQVRDQAEHLKT---AVQMAV-------FIHNKKRKGGRIVDIIATDIQ-------