[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bxzB.bssp"
#ERROR : Can't open dsspfile "1cu1A.bssp"
#ERROR : Can't open dsspfile "3eiqD.bssp"
#ERROR : Can't open dsspfile "2c5uA.bssp"
#ERROR : Can't open dsspfile "3crw1.bssp"
#ERROR : Can't open dsspfile "2db3A.bssp"
#ERROR : Can't open dsspfile "2bhrA.bssp"
#ERROR : Can't open dsspfile "1b47A.bssp"
#ERROR : Can't open dsspfile "3eiqA.bssp"
#ERROR : Can't open dsspfile "2bmfB.bssp"
#ERROR : Can't open dsspfile "1d2mA.bssp"
#ERROR : Can't open dsspfile "3dkpA.bssp"
#ERROR : Can't open dsspfile "3dinA.bssp"
#ERROR : Can't open dsspfile "3berA.bssp"
#ERROR : Can't open dsspfile "1c4oA.bssp"
#ERROR : Can't open dsspfile "3eirB.bssp"
#ERROR : Can't open dsspfile "1dhsA.bssp"
#ERROR : Can't open dsspfile "3dwlD.bssp"
#ERROR : Can't open dsspfile "3borA.bssp"
#ERROR : Can't open dsspfile "3eirA.bssp"
#ERROR : Can't open dsspfile "1c69A.bssp"
#ERROR : Can't open dsspfile "3earA.bssp"
#ERROR : Can't open dsspfile "3buwB.bssp"
#ERROR : Can't open dsspfile "2b2nB.bssp"
#ERROR : Can't open dsspfile "2b2nA.bssp"
#ERROR : Can't open dsspfile "3eaqB.bssp"
#ERROR : Can't open dsspfile "149lA.bssp"
#ERROR : Can't open dsspfile "3easA.bssp"
#ERROR : Can't open dsspfile "3dofB.bssp"
#ERROR : Can't open dsspfile "3cdrA.bssp"
#ERROR : Can't open dsspfile "3b6eA.bssp"
#ERROR : Can't open dsspfile "1dydA.bssp"
#ERROR : Can't open dsspfile "3crvA.bssp"
#ERROR : Can't open dsspfile "3bxzA.bssp"
#ERROR : Can't open dsspfile "2d7uA.bssp"
#ERROR : Can't open dsspfile "3eaqA.bssp"
#ERROR : Can't open dsspfile "1d9zA.bssp"
#ERROR : Can't open dsspfile "3e0jC.bssp"
#ERROR : Can't open dsspfile "2dgdA.bssp"
#ERROR : Can't open dsspfile "3dl8A.bssp"
#ERROR : Can't open dsspfile "1d9xA.bssp"
#ERROR : Can't open dsspfile "1d9wA.bssp"
#ERROR : Can't open dsspfile "2d7dA.bssp"
#ERROR : Can't open dsspfile "3dddA.bssp"
#ERROR : Can't open dsspfile "3c80A.bssp"
#ERROR : Can't open dsspfile "3dzaA.bssp"
#ERROR : Can't open dsspfile "3dzaD.bssp"
#ERROR : Can't open dsspfile "3cpeA.bssp"
#ERROR : Can't open dsspfile "2b99A.bssp"
#ERROR : Can't open dsspfile "2bwxA.bssp"
#ERROR : Can't open dsspfile "3dmqA.bssp"
#ERROR : Can't open dsspfile "3dzaC.bssp"
#ERROR : Can't open dsspfile "2bwwA.bssp"
#ERROR : Can't open dsspfile "2bwsA.bssp"
#ERROR : Can't open dsspfile "1a16A.bssp"
#ERROR : Can't open dsspfile "1a1vA.bssp"
#ERROR : Can't open dsspfile "2bwvA.bssp"
#ERROR : Can't open dsspfile "1az9-.bssp"
#ERROR : Can't open dsspfile "2ekdA.bssp"
#ERROR : Can't open dsspfile "1e2bA.bssp"
#ERROR : Can't open dsspfile "2bhrB.bssp"
#ERROR : Can't open dsspfile "3b94A.bssp"
#ERROR : Can't open dsspfile "2bmfA.bssp"
#ERROR : Can't open dsspfile "2bwyA.bssp"
#ERROR : Can't open dsspfile "2dymE.bssp"
#ERROR : Can't open dsspfile "2bwuA.bssp"
#ERROR : Can't open dsspfile "2ekyB.bssp"
#ERROR : Can't open dsspfile "1br9A.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "2dxcH.bssp"
#ERROR : Can't open dsspfile "1ekuA.bssp"
#ERROR : Can't open dsspfile "2bwtA.bssp"
#ERROR : Can't open dsspfile "1dxjA.bssp"
#ERROR : Can't open dsspfile "1eaqA.bssp"
#ERROR : Can't open dsspfile "2ekdA.bssp"

## Summary of PDB Search
:634
    2e-65  13%  3bxzB  [x.x.x] PREPROTEIN TRANSLOCASE SUBUNIT SECA
    3e-64  14%  1cu1A  [c.37.1 - c.37.1 - b.47.1] PROTEIN (PROTEASE/HELICASE NS3)
    1e-59  33%  3eiqD  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    4e-53   7%  2c5uA  [x.x.x] RNA LIGASE
    2e-52  12%  3crw1  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    8e-48  31%  2db3A  [x.x.x] ATP-DEPENDENT RNA HELICASE VASA
    3e-44  13%  2bhrA  [x.x.x] RNA HELICASE
    1e-43   9%  1b47A  [a.48.1 - a.39.1 - d.93.1] CBL
    2e-43  31%  3eiqA  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
    7e-41  13%  2bmfB  [x.x.x] RNA HELICASE
    2e-39  16%  1d2mA  [c.37.1 - c.37.1] EXCINUCLEASE ABC SUBUNIT B
    2e-39  30%  3dkpA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX52
    1e-38  15%  3dinA  [x.x.x] PROTEIN TRANSLOCASE SUBUNIT SECA
    2e-37  38%  3berA  [x.x.x] PROBABLE ATP-DEPENDENT RNA HELICASE DDX47
    3e-37  18%  1c4oA  [c.37.1 - c.37.1] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB
    4e-37  18%  3eirB  [x.x.x] PUTATIVE ATP/GTP BINDING PROTEIN
    1e-36  12%  1dhsA  [c.31.1 (1rlzA)] DEOXYHYPUSINE SYNTHASE
    2e-36  10%  3dwlD  [x.x.x] ACTIN-RELATED PROTEIN 2/3 COMPLEX SUBUNIT 2
    4e-33  32%  3borA  [x.x.x] HUMAN INITIATION FACTOR 4A-II
    9e-33  16%  3eirA  [x.x.x] PUTATIVE ATP/GTP BINDING PROTEIN
    4e-31   7%  1c69A  [d.2.1] PROTEIN (LYSOZYME)
    9e-31  39%  3earA  [x.x.x] HERA
    1e-30  10%  3buwB  [a.48.1 - a.39.1 - d.93.1 (2cblA)] E3 UBIQUITIN-PROTEIN
    8e-30   8%  2b2nB  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    6e-29   9%  2b2nA  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    6e-29  42%  3eaqB  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    2e-26  12%  149lA  [x.x.x] T4 LYSOZYME
    3e-26  37%  3easA  [x.x.x] HERA
    5e-26  15%  3dofB  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2-BINDING
    9e-26  13%  3cdrA  [x.x.x] LYSOZYME
    2e-24  15%  3b6eA  [x.x.x] INTERFERON-INDUCED HELICASE C DOMAIN-CONTAINING
    2e-24  11%  1dydA  [x.x.x] T4 LYSOZYME
    3e-24  12%  3crvA  [x.x.x] XPD/RAD3 RELATED DNA HELICASE
    6e-24  13%  3bxzA  [x.x.x] PREPROTEIN TRANSLOCASE SUBUNIT SECA
    9e-24  12%  2d7uA  [x.x.x] ADENYLOSUCCINATE SYNTHETASE
    1e-22  41%  3eaqA  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    7e-22  19%  1d9zA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    2e-21  11%  3e0jC  [x.x.x] DNA POLYMERASE SUBUNIT DELTA-2
    2e-21   9%  2dgdA  [x.x.x] 223AA LONG HYPOTHETICAL ARYLMALONATE
    4e-21  17%  3dl8A  [x.x.x] PROTEIN TRANSLOCASE SUBUNIT SECA
    5e-21  17%  1d9xA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    1e-20  15%  1d9wA  [d.2.1] PROTEIN (LYSOZYME)
    1e-20  12%  2d7dA  [x.x.x] UVRABC SYSTEM PROTEIN B
    2e-20  16%  3dddA  [x.x.x] PUTATIVE ACETYLTRANSFERASE
    2e-19   8%  3c80A  [x.x.x] LYSOZYME
    2e-19  10%  3dzaA  [x.x.x] UNCHARACTERIZED PUTATIVE MEMBRANE PROTEIN
    5e-19  11%  3dzaD  [x.x.x] UNCHARACTERIZED PUTATIVE MEMBRANE PROTEIN
    7e-19   8%  3cpeA  [x.x.x] DNA PACKAGING PROTEIN GP17
    9e-19   9%  2b99A  [x.x.x] RIBOFLAVIN SYNTHASE
    3e-18  10%  2bwxA  [x.x.x] AMINOPEPTIDASE P
    5e-18  18%  3dmqA  [x.x.x] RNA POLYMERASE-ASSOCIATED PROTEIN RAPA
    2e-17  10%  3dzaC  [x.x.x] UNCHARACTERIZED PUTATIVE MEMBRANE PROTEIN
    2e-17   8%  2bwwA  [x.x.x] AMINOPEPTIDASE P
    4e-17  11%  2bwsA  [x.x.x] XAA-PRO AMINOPEPTIDASE P
    4e-17  10%  1a16A  [x.x.x] AMINOPEPTIDASE P
    1e-16  10%  1a1vA  [c.37.1 - c.37.1] PROTEIN (NS3 PROTEIN)
    7e-16   9%  2bwvA  [x.x.x] AMINOPEPTIDASE P
    3e-14   9%  1az9-  [c.55.2 - d.127.1] AMINOPEPTIDASE P
    4e-13   9%  2ekdA  [x.x.x] HYPOTHETICAL PROTEIN PH0250
    9e-13  22%  1e2bA  [x.x.x] ENZYME IIB-CELLOBIOSE
    6e-12  14%  2bhrB  [x.x.x] RNA HELICASE
    7e-12  14%  3b94A  [x.x.x] TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER
    2e-11  13%  2bmfA  [x.x.x] RNA HELICASE
    3e-11  10%  2bwyA  [x.x.x] AMINOPEPTIDASE P
    2e-10   9%  2dymE  [x.x.x] AUTOPHAGY PROTEIN 5
    2e-10  10%  2bwuA  [x.x.x] AMINOPEPTIDASE P
    6e-10  10%  2ekyB  [x.x.x] UPF0045 PROTEIN MJ1052
    3e-08   6%  1br9A  [x.x.x] METALLOPROTEINASE-2 INHIBITOR
    5e-06  20%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-05   8%  2dxcH  [x.x.x] THIOCYANATE HYDROLASE SUBUNIT BETA
    2e-05   9%  1ekuA  [a.26.1 - a.26.1] INTERFERON GAMMA
    3e-05  10%  2bwtA  [x.x.x] XAA-PRO AMINOPEPTIDASE P
    3e-05  14%  1dxjA  [d.2.1] CLASS II CHITINASE
    3e-04   9%  1eaqA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    3e-10  10%  2ekdA  [x.x.x] HYPOTHETICAL PROTEIN PH0250(query 72->258)
:634

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLDKLDAMLNADAAPAVEASENGFAKLGLDAAILRALAEANYN
3bxzB           ----------------------------LSDEELKGKTAEFRARLEKGEVLENLIPEAFAVVREASKRVF
1cu1A           --------------------------------------------------RGVAKAVDFVPVESMETTMR
3eiqD           --------------------------------------------------FDDMNLSESLLRGIYAYGFE
2c5uA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
2db3A           -----------------------------NNIPVKVTGSDVPQPIQH---FTSADLRDIIIDNVNKSGYK
2bhrA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3eiqA           --------------------------------------------------FDDMNLSESLLRGIYAYGFE
2bmfB           ---------------------------------------------------------------------A
1d2mA           ----------------------------------------------------------------------
3dkpA           --------------------------------------DLPDPIATFQQLDQEYKINSRLLQNILDAGFQ
3dinA           ----------------------------------------------------------------------
3berA           ------------------------------------------VEEEETKTFKDLGVTDVLCEACDQLGWT
1c4oA           ----------------------------------------------------------------------
3eirB           ----------------------------------------------SVTDFGGLENYKELTGGADPFALM
1dhsA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
3borA           ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
3eirA           -----------------------------RYDTLLIARDPREAIEKSVTDFGGLENYKELTGGADPFALM
1c69A           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
3b6eA           --------------------------------------------------------EENVAARASPEPEL
1dydA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3bxzA           --------------------------------------------------LENLIPEAFAVVREASKRVF
2d7uA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------EFEKELKYSYSL
3dl8A           -----------------------------DALKHKTIEFKERLEKGATTDDLLVEAFAVVREASRR--VT
1d9xA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
3c80A           ----------------------------------------------------------------------
3dzaA           ----------------------------------------------------------------------
3dzaD           ----------------------------------------------------------------------
3cpeA           ------------------------------------------------DIVYFAETYCAITHIDYGVIKV
2b99A           ----------------------------------------------------------------------
2bwxA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3dzaC           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2bwvA           ----------------------------------------------------------------------
1az9-           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1e2bA           --------------------------------------------------FSSAGMSTSLLSKMRAQAEK
2bhrB           ----------------------------------------------------------------------
3b94A           --------------------------------------------------YGQVAFEVRLYKNKD--MIQ
2bmfA           ----------------------------------------------------------------------
2bwyA           ----------------------------------------------------------------------
2dymE           -----------------------------------------------------VNEARKFWGSVITRNFQ
2bwuA           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
1br9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2dxcH           ---------------------------------------------HRHLGTV-ALMQPALHQQTHAPAPT
1ekuA           ----------------------------------------------------------------------
2bwtA           ----------------------------------------------------------------------
1dxjA           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TPTPVQAQAIPAFLAGRDLLVSSQTGSGKTAAFMLPAIQRISEKPATHRPTEPAKRMKGKRPRPSPAQPS
3bxzB           GMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNALTGKGVH----------------------
1cu1A           SPVFTDNSSPPAVPQFQVAHLHAPTGSGKSTKVPAAYAAQ---------------------------GYK
3eiqD           KPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQI---------------------ELDLKATQ
2c5uA           ---LFNNLELCKDSQRKFFYSDDVSASGRTYRIFSYNYASY-----------------SDWLLPDALECR
3crw1           ---KLKDKVIEGLRNNFLVALNAPTGSGKTLFSLLVSLEVK---------------------------PK
2db3A           IPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP----------------HELELGRPQ
2bhrA           ----IEDDIF---RKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRT----------------------
1b47A           ----------------------PGTVDKKMVEKCWKLMDKVVRLCQNP--------------------KL
3eiqA           KPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQI---------------------ELDLKATQ
2bmfB           SIEDNPEIEDDIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRG-----------------------LR
1d2mA           ----------------------------------------------------------------------
3dkpA           MPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSIPILMQLKQPANKGFRA-------------------
3dinA           ----------------------------------------------------------------------
3berA           KPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALV------------------
1c4oA           ----------------------------------------------------------------------
3eirB           TPVGLSANNIFKLMTEKDVPID------------------------------------------------
1dhsA           GALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNF----------------------
3dwlD           ----------------------------------------------------------------------
3borA           KPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQAL-------------------
3eirA           TPVGLSANNIFKLMTEKDDPTSIEYLENTSFAEHVNTLDSHKNY--------------------------
1c69A           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3buwB           ----------PPGTVDKKMV-------EKCWKLMDKVVRLCQNPKLALKNSPPY----------------
2b2nB           -------------------------------ACATLVAEIAERH-----------------------AGP
2b2nA           -------------------------------ACATLVAEIAERH-----------------------AGP
3eaqB           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
3b6eA           QLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHL-----------------DKKKKASEPGKV
1dydA           ----------------------------------------------------------------------
3crvA           -LRDWQEKLKEGLRNNFLVALNAPTGSGKTLFSLLVSLEVKPKV--------------------------
3bxzA           GMRHFDVQLLGGMVLNERCIAEMRTGEGKTLTATLPAYLNALTGKGVHVV--------------------
2d7uA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
3e0jC           -----------------HHGMFSEQAAQRAHTLLSPPSANN-------------------------ATFA
2dgdA           LAEVSDIIIYGRTYGTHKAHVIKRVIKDVVIPEESVYELLKKLN----------------------VRKL
3dl8A           GMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHV---------------------
1d9xA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
2d7dA           QPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNL-------------IKEVNKPTL-------
3dddA           ----------------------------------------------------------------------
3c80A           ----------------------------------------------------------------------
3dzaA           ----------------------------------------------------------------------
3dzaD           ----------------------------------------------------------------------
3cpeA           QLRDYQRDMLKIMSSKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVG--------------------
2b99A           ----------------------------------------------------------------------
2bwxA           ----------------------------------------------------------------------
3dmqA           SLIPHQLNIAHDVGRAPRVLLADEVGLGKTIEAGILHQQLLSGAAERV----------------------
3dzaC           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
1a1vA           ----------AVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVL-------------------------
2bwvA           ----------------------------------------------------------------------
1az9-           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1e2bA           YEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKP------------------------
2bhrB           SIEDNPEIEDDIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVV-------------
3b94A           TLTNKQNVGGTYELHVGDTIDLIFNLKNNTGIILLANPQ-------------------------------
2bmfA           SIEDNPEIEDDIFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVV-------------
2bwyA           ----------------------------------------------------------------------
2dymE           DFIEISNKIIPLIIQTSRTRISQPTISMTGVNPTLKDIEGD------------------------ILDVM
2bwuA           ----------------------------------------------------------------------
2ekyB           ---------MIFMRKVVAEVSIIPLGKGASVSKYVKKAIEV-------------FKKYDLKVETNA--MG
1br9A           ----------------------------------------------------------------------
3b85B           -KTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQ-----------------------------
2dxcH           EITHTLFRAYTRVPHDEEIWELNTFATCECLAWRGVWTAEERRRKQNC----------------------
1ekuA           ----------------------------------------------------------------------
2bwtA           ----------------------------------------------------------------------
1dxjA           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
2ekdA           -KFFKLFRVGETVLVEAELLLYYIVNNSKLPIVVDDILDTYYEFYTRLKV--------------------


                         +         .         .         .         .         *         .:210
query           LLVLTPTRELALQVTEAAAKYGRHLRRIVCASILGGMPYPKQLAMLARMPDILVATPGRLLDHIEAGRID
3bxzB           --VVTVNDYLAQRDAENNRPLFEF-LGLTVGINLPGMPAPAKREAYAADITYGTNNEYGFDYLRVQRKLH
1cu1A           VLVLNPSVAATLGFGAYMSKAHGI-----------DPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGA
3eiqD           ALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLS
2c5uA           GIFEDGEKPVRIASRPEKFFNLNEN----PFTNIDLNDVDYILTKEDGSLVSTYLDGDEILFKSKGSIKS
3crw1           VLFVVRTHNEFYPIYRDLTKIR----EITFSFLVGKPSSCLESENSLYKADVIALTPYFFIDRYREFIDI
2db3A           VVIVSPTRELAIQIFNEARKFAFESYLKIGIVY-GGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFIT
2bhrA           -LILAPTRVVAAEMEEALRGLPIRYQREIVD-LMCHATFTMRLLSPIRVPNYN-----------------
1b47A           ALKNSPPYILDLLP--------------------DTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKK
3eiqA           ALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLS
2bmfB           TLILAPTRVVAAEMEEALRGLPIRYQTGRE----------------IVDLMCHATFTMRLLSPIRVPNYN
1d2mA           -YFEERGEVLYAQRLKERTLYDLEML------RVMGTCPGVENYARYFTGKAPGEPPYTLLDYFPEDFLV
3dkpA           -LIISPTRELASQIHRELIKISEGTGFRIHMIHKAAVAAKKFGPKSSKKFDILVTTPNRLIYLLKPPGID
3dinA           ----------------------------------IGVENLYDPGNVSLLYHLINALKALHLFKKD-VDYV
3berA           ---LTPTRELAFQISEQFEALGSSIG-VQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENTKGN
1c4oA           ----------------------------------------------------------------------
3eirB           -----PTSIEYLETSFAEHVNTLDSYVVIVNDGRLGHKFLIDLPALTRTAYIIQSDLGALPAVRVEDWIS
1dhsA           ---GRAVQQVNAMIEKKLEPLTSCTIFLGYTSNLIGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAP
3dwlD           ------------------LSLDYNNIFIYELLTERFSSENQVVTDFDG-VTFHISTPTKILISLYGTLDL
3borA           --VLAPTRELAQQ-------------IQKVILALGDYMGATCHACIGEAPHIVVGTPGRVFDMLNRRYLS
3eirA           --VVIVNDGRLGHKFL-----------IDLPALRTAYIIQSD-------LGGGALPAVRVEDWISRRGSD
1c69A           ---------------------------FEMLRIDEGLRLTEGYYTIGIGHLLTKSPSLNAAKSELDKAIG
3earA           ----------------------------------------------------------------------
3buwB           ------ILDLLPDTYQHLRTILSRYEGKME----------------------TLGENEYFRVFMENLMKK
2b2nB           VVLIAPDMQNALRLHDEISQFTDQMVMNLAHQDIISSRLSTLYQLPTMQRGVLIVPVNTLMQRVHGHALV
2b2nA           VVLIAPDMQNALRLHDEISQFTDQMVMNLADWDIISSRLSTLYQLPTMQRGVLIVPVNTLMQRLHGHALV
3eaqB           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3dofB           --------------------------------------------------------------------AV
3cdrA           ----------------------------------------------------------------------
3b6eA           IVLVNKVLLVEQLFRKEFQPFLKK-----WYRVIGLSGLKISFPEVVKSCDIIISTAQILENSLL-NGVQ
1dydA           ----------------------------------------------------------------------
3crvA           -LFVVRTHNEFYPIYRDLTKIREKRNITFS-FLVGKPSSCLYAEKGAESEDIPCKYCELKGSIVEVKTDD
3bxzA           ----TVNDYLAQRDAENNRPLFEF-LGLTVGINLPGMPAPAKREAYAADITYGTNNMAFSPEERVQRKLH
2d7uA           --------------------------------IPTGFMQTKA--RLLIGAGVLVDPEVFFHELEQLKDFN
3eaqA           ----------------------------------------------------------------------
1d9zA           --------------------------------------------------------PYTLLDYFPDDFLI
3e0jC           RVPVATYTNSSQPFRLIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELKCCVVGTLFKAMSKY-----I
2dgdA           WIGTPYIKERTLEEVEWWRNKGFE-----IVGYDGLGKIRGIDISNTPIFTIYRLVKRHLNEVLKADAVY
3dl8A           ---VTVNEYLASRDAEQMGKIFEFLGLTVGLNL-NSMSKDEKREAYAADNNELGFDYLRDNMVLYKEQMV
1d9xA           ------------------------------------------------------STPYTLLDYFPDDFLI
1d9wA           ----------------------------------------------------------------------
2d7dA           --VIAHNKTLAGQLYSEFKEFFPNN-AVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLSATSAL
3dddA           ----------------------------------------------------------------------
3c80A           ---------------------IFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIG
3dzaA           ----------------------------------------------------------------------
3dzaD           ----------------------------------------------------------------------
3cpeA           --ILAHKGSMSAE----------VLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSSIGAYASSPDAVR
2b99A           ----------------------------------------------------------------------
2bwxA           ----------------------------------------------------------------------
3dmqA           -LIIVPETLQHQWLVELR----RFNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQLEHLC
3dzaC           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
1a1vA           --VLNPSVAATLGFGAYMSKAHGV-----------DPNIRTGVRTITTGSPITYSTYGKFLADGGSGGAY
2bwvA           ----------------------------------------------------------------------
1az9-           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1e2bA           -VEVIDSLLYGKVDGLGV----------------------------------------------------
2bhrB           ----------------------------------------------------------------------
3b94A           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
2bwyA           ----------------------------------------------------------------------
2dymE           VICQGIEIPWHMLLYDLYSKLRSFD-GFLYITLV------------------------------------
2bwuA           ----------------------------------------------------------------------
2ekyB           TVLEGDLDEILKAFKEAHSTVLNDVDRVV-SSLKIDERKDKENTILKAIGEL------------------
1br9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2dxcH           --DVGQTVYLGMPYYGRWLLTAARI-LVDKQFVTLTELHNKIVEMRERVASG-QGLGEYLPPKA------
1ekuA           ----------------------------------------------------------------------
2bwtA           ----------------------------------------------------------------------
1dxjA           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------VLADHPGELVRT
2ekdA           -AGFDVAPLENVQVIKGGTKDIGRVIGRLNI-SKYVISEQEYEIVSQLKINPVLGLHKLILLGNTFENIN


                         .         .         .         +         .         .         .:280
query           LSALEMLVFDEADRMLDMGFADDIDAIVAATPASRQTLMFSATLDARIAQLASRQLRDPQRIEIAAARAD
3bxzB           YALVDEVDSILIDEARTPLIILASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR
1cu1A           YDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVP---------------------
3eiqD           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELT
2c5uA           EQALANGILNINHHRLRDRLKELAEDGFTANFEFVAPTNRIVLAYQEKIILLNVRENETGEYISYDDIYK
3crw1           DLREYMIVIDEAHNLDKVNELEERSRILSKLLNQLREVVLPDEKYIKVENVPKLSKEELEILADDYEDIR
2db3A           FEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVG
2bhrA           -----LIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIM----DEEREIP
1b47A           TKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKAKAFGEKTIVPW
3eiqA           PKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELT
2bmfB           LIIMDEAHFTDPASIAARGYISTRVEMGEAAGIFMTATPPGSR------------------------DPF
1d2mA           FLDESHVTVPQLQGMYRGDYARKKTLVDYGRPLRFEEFLERVSQVVFVSATPGPFELAHSGRVVEQIIRP
3dkpA           LASVEWLVVDESDKLFEDGGFRDASIFLACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIGA----
3dinA           VMNGEVIIVDEFTGRLLPGRRQAIEAKEGVPIKEESITYATITFQNYFRMYEKLAGMTGTAKTEESEFVQ
3berA           LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSS----
1c4oA           -----VFLDESHVTVPQLQGMYRGDYARKKTLVDYGFRLPSALDNRPLRFEEFLERVSQVVFVSATPGPF
3eirB           RRGSDPVSLDELNQLLSKDFSK--------MPDDVQTRLLASILQ---------IDKDPHKVDI--KKLH
1dhsA           TYLGEFSLRGKELRENGINRIGNL------LVPNENYCKFEDWLMPILDQMVMEQNTEGVKW--------
3dwlD           LKQIYGAYVHEPEMGYNFSILIDLQQLPADEEKEQLAMSISMLKRNVLAAPFHRAFTKQAELAPMLDKQA
3borA           PKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRI--------
3eirA           -----PVSLDELNQLLSKDFSK--------MPDDVQTRLLASILQID---------KDPHKVDIK--KLH
1c69A           RNCNGVITKDEAEKLFNQDVDAAVRGVYDSLDAVRRCALINMVFQMGETGV-AGFTNSLRMLQQKRWDEA
3earA           ----------------------------------------------------------------------
3buwB           TKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAFGEKTIVPW
2b2nB           MKKGQRLSRDALRTQDSAGYRDQVMEHGEYATRGALLDLFPMGSELPYRLFFDDEIDSLRVFDVDSQRTL
2b2nA           MKKGQRLSRDALRTQLSAGYVDQVMEHGEYATRGALLDLFPMGSELPYRLDFDDEIDSLRVFDVDSQRTL
3eaqB           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3dofB           VGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEELIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTT
3cdrA           ----------------------------------------------------------------------
3b6eA           LSDFSLIIIDECVYNNIMRHYLMQKKENKPVIPLPQILGLTAS---------------------------
1dydA           ----------------------------------------------------------------------
3crvA           SPLSLVKKLKKDGLQDKFCPYYSLLNS--LYKADVIALTYPYFFIDRYREFIDIDLREYMIV--------
3bxzA           YALVDEVDSILIDEARTPLIILASITFQNYFRLYEKLAGMTGTADTEAFEFSSIYKLDTVVVPTNRPMIR
2d7uA           VKDRVG-IDYRCAIIEEKHKQSGCGPANADRVMRKAKQAKDVKELEPVAQEINDALDEGSLVLVEGTQGF
3eaqA           ----------------------------------------------------------------------
1d9zA           IVDESHVTLPQLRGMYNGDRAQVLVDHGFRLPSANRPLTFEEF-EQKINQIIYVSATPGPYEHSPGVVEQ
3e0jC           HPDDELVLEDELQR-----IKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKP------
2dgdA           IACTALSTYEAVQYLHEDLDP--VVSENAAAWEALNKLKIKAKL--------------------------
3dl8A           QRPLHFAVIDEVDSILIDEARTPL--IISGQAAKSTKLYVQANAFVRTLKAEKDYTYDIKTKAVQLTEEG
1d9xA           IVDESHVTLPQLRGMYNGDRADNRPLTFEEFEQKINQIIYVSATPGPYELEHSPGVVEQIIRP-------
1d9wA           ----------------------------------------------------------------------
2d7dA           FERRDVIIIASVSCIYGLGSPEEYREMVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTF--------
3dddA           ----------------------------------------------------------------------
3c80A           RNCNGVITKDEAEKLFNQDVNAKLKPVYDSLDAVRYCALINMVFQMGETGVA-GFTNSLRMLQQKRWDEA
3dzaA           ----------------------------------------------------------------------
3dzaD           ----------------------------------------------------------------------
3cpeA           GNSFAMIYIEDCAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGFEPYTAIW
2b99A           ----------------------------------------------------------------------
2bwxA           ----------------------------------------------------------------------
3dmqA           EAEWDLLVVDEAHHLVWSEPSREYQAIEQLAEHVPGVLLLTAT---------------------------
3dzaC           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
1a1vA           DIIICDECHSTDATSILGIGTVLDQAE---TAGARLVVLATATPPGSV----------------------
2bwvA           ----------------------------------------------------------------------
1az9-           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
3b94A           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
2bwyA           ----------------------------------------------------------------------
2dymE           ----------------------------------------------------------------------
2bwuA           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
1br9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
1ekuA           ----------------------------------------------------------------------
2bwtA           ----------------------------------------------------------------------
1dxjA           ---------------------------------------------------------YAQAGRALGVDLI
1eaqA           DSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVAGNDENYSAELRNATAAKNQVARF------
2ekdA           VVKVSNYVGRE-ERIAFYFVNRNV-IEKHSSPILD-LLEEVVTSILEI----------------------


                         .         *         .         .         .         .         +:350
query           HSNIEQRLHFTDDMSHKERLLDHLLRDASLKQAIVFTATKRDADSLAERLSDTGFSAGALHGDMTQGARN
3bxzB           KDLPDLVYMTEAEKIQAIIED-IKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLNAKFHANEAA
1cu1A           HPNIEEVALSNTGE-IPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIP
3eiqD           LEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMDMDQKE----
2c5uA           DATLRPYLVERYEIDSPKWIEEAKNAGYVAVKDGSHFKIKSDWYVSLHSTKSSLDNPEKLFKTIIDGASD
3crw1           KDSLKQKIHIGSI--LRFFSLLSIGSFIPFSYSKRLVIKNPEISYYLNLLNDNELSIILMSGTLPPREYM
2db3A           GACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQRE
2bhrA           ERSWNS-GHEWVTDFK--------------GKTVWFVPSIKAGNDIAACLRKNGKKVIQLSRKTFDSEYI
1b47A           KSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLAVTHPGYMAFLTYDEVK
3eiqA           LEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMMDQKERDVIM
2bmfB           PQSNAPIMDEEREIPERSWNSGHEWVTDFKGKTVWFVPSIKAGNDIAACLRKNGKKVIQLSRKTFDSEYI
1d2mA           TGLLDPLVRVKPTENQILDLMEGIRRAARGERTLVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQ
3dkpA           ----------------------------------------------------------------------
3dinA           VYGMEVVVIPTHKPMIRKDHDDLVFRTQKEKPVLVGTTSIEKSELLSSMLKKKGIPHQVLNAKYHE--KE
3berA           ----------------------------------------------------------------------
1c4oA           ELAHSGRVVEQIIRPTGLLDPLVRVKPTENQRTLVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQ
3eirB           LDGKLRFASHEYDFRQFQRNAQYV----------------------------------------------
1dhsA           -----TPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLG-DMIFFHSYKNPGLVLDIVEDLRL
3dwlD           TSQELMAIHYRDEETIVLWPEHDR------VTVVFSTKFREETDRIFGKVFLQEFVD--ARRTAPQVLFS
3borA           ----------------------------------------------------------------------
3eirA           LDGKLRFASHEYDFRQFQRNAQYV----------------------------------------------
1c69A           AVNAAKSRWYNQT-PNRAKRVITTFRTGTWDA--------------------------------------
3earA           --TYEEEAVPAPV-RGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
3buwB           KSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQRNWNSLAVTHPGYMAFLTYDEVK
2b2nB           EEVEAINLLPAHEFPTDKAAI-ELFRSQWRDTFEVKRDPEHIYQQVSKGTLPAG----------------
2b2nA           EEVEAINLLPAHEF-PTDKAAIELFRSQWRDTFEVKRDPEHIYQQVSKGTLPAGI---------------
3eaqB           ---YEEEAVPAPV-RGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
149lA           ------------------NLFEMLRIDEGLR-LKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGR
3easA           ----EEEAVPAPV-RGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
3dofB           LQHHKDEV--------AGDIFDMLLTFTDFLAFKEMFLDYRAEK--------------------------
3cdrA           -------------------IFEMLRIDEGLR-LKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGR
3b6eA           ----------------------------------------------------------------------
1dydA           -----------------------------------------------------SPSLNAAKSELDKAIGR
3crvA           -----------IDEAHNLDKVNELEERSLSEITIQMAIKQSKSEESRRILSKLLNQLREVVLPDEKYIKV
3bxzA           KDLPDLVYMTEAEK-IQAIIEDIKERTAKGQPVLVGTISIEKSELVSNELTKAGIKHNVLNAKFHANEAA
2d7uA           GLSLYYGTYPYVTSKDVTASSVAAD----VGIGPTRVDEVIVVFKSFPTRVGAGPFPTEMPMEEADRLGL
3eaqA           ---YEEEAVPAPV-RGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERE
1d9zA           IIRPTGLLDPTIDVRPTKGQIDDLIGEERNERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERI
3e0jC           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
3dl8A           MTKAEKAFGIDNLFDVKHVALNH-----------------------------------------------
1d9xA           TGLLDPTIDVRPTKGQIDDLIGEIRERVERERTLVTTLTKKMAEDLTDYLKEAGIKVAYLHSEIKTLERI
1d9wA           -------------------------------------------------LLTKSPSLNAAKSELDKAIGR
2d7dA           ----------------------------------------------------------------------
3dddA           ------------------------------------------------------AENEGFGLVYRGKIGP
3c80A           AVNLAKSRWYNQT-PNRAKRVITTFRT-------------------------------------------
3dzaA           ---------------------------AAAATTQVQKEAADVLQVAVQGANARDIQFARLALFHGQPDSA
3dzaD           -------------------------------ATTQVQKEAADVQVAVQGANARDIQFARLALFHGQPDSA
3cpeA           NSVKERLYNDEDIFDDGWQ--WSIQTINGSSLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHG
2b99A           ----------------ASIAIKKLKELS--PNIKIIRKTVPGIKDLPVACKKLGCDIVMALGMPGKAEKD
2bwxA           ----------------------------------------------------------EISRQEFQRRRQ
3dmqA           ------------------------------------------------------------EGSIIERDRA
3dzaC           ---------------------------------QVQKEAADVLQVAVQGANARDIQFARLALFHGQPDSA
2bwwA           ----------------------------------------------------------EISRQEFQRRRQ
2bwsA           ----------------------------------------------------------EISRQEFQRRRQ
1a16A           ----------------------------------------------------------EISRQEFQRRRQ
1a1vA           TVPHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSV
2bwvA           ----------------------------------------------------------EISRQEFQRRRQ
1az9-           ----------------------------------------------------------EISRQEFQRRRQ
2ekdA           -------------------YYEFYTRLKVAGFDVAPLENVQVIKGGTKDIGRVIGRLNISKYVISEQEYE
1e2bA           ----------------------------------------------------------------------
2bhrB           --------------------------------------SIKAGNDIAACLRKNGKKVIQLSRKTFDSEYI
3b94A           ----------------------------------------------------------------------
2bmfA           ---------EEREIPERSWNSGHEWVTDFKGKTVWFVPSIKAGNDIAACLRKNGKKVIQLSRKTFDSEYI
2bwyA           ----------------------------------------------------------EISRQEFQRRRQ
2dymE           ----------------------------------------------------------------------
2bwuA           ----------------------------------------------------------EISRQEFQRRRQ
2ekyB           ----------------------------------------------------------------------
1br9A           ------------DVVIRAKAVSEKEVDSGNDYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGV
3b85B           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
1ekuA           --------------ADNGTLFLGILKNEESDRKIMQSQIVSFYFKL-FKNFKDDQSIQKSVETIKEDMNV
2bwtA           ----------------------------------------------------------EISRQEFQRRRQ
1dxjA           NNDLVARDAVISFKTAIWFWMTPQGNKPSCHDVITNRWTPSAADVAANRTPGFGVITNIINGGIECGRGP
1eaqA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RTLTALRRGNLRVLVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAGRSGVAINLVNHGDMF
3bxzB           IVAQAGYPAAVTIATNMAGRGTDIVLAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDA-
1cu1A           TIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLTIETTTVPQDAVSRSQRRG------------
3eiqD           ----RDVIMREFVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKR
2c5uA           DLKAYADDE-------YSYRKIEAFETTYLKYLDRALFLVLDCHNKHCGKDRKTYAEAQGVAKGAGDHLF
3crw1           EKVWGIKRNMLYLDVEREIQKRVSGSYECYIGVDVTSDNMWKRYADYLLKIYFQAKANVLVVFPSYEIMD
2db3A           QALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPKDRA
2bhrA           K----TRTNDWDFVVTTDISEMGANFKAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQR----
1b47A           ARLQKFIHKPGSYIFCTRLGQWAIGYVTADGNILQTIPHN-KPLFQALIDGFREGFYLFPDGRNQNPDL-
3eiqA           R--------EFRSGVLITTDLLAIDVQQVSLVINYDLPTNRENYIHRIGR-------GVAINMVTEEDKR
2bmfB           K----TRTNDWDFVVTTDISEMGANFKAERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEPLE
1d2mA           ALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGRSLIQTIGRAARNAR-GEVWLYADRVSEA
3dkpA           ----------------------------------------------------------------------
3dinA           AEIVAKAGQKGMVTIATNMAGRGTDIKLGLCIIGTERHESRRIDNQLRGRAGRQGDPGESIFFLSLEDDL
3berA           ----------------------------------------------------------------------
1c4oA           ALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEERSLIQTIGRAARNAR-GEVWLYADRVSEA
3eirB           ----------------------------------------------------------------------
1dhsA           INTQAIFAKC------TGMIILGGGVVK-HHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVS--
3dwlD           YRDPPLEIRDIQFGVTFVLFERHFTPQNREDCISHIQVF--RNTLHFHIKASKAYMHQRMRKRVAD----
3borA           ----------------------------------------------------------------------
3eirA           ----------------------------------------------------------------------
1c69A           ----------------------------------------------------------------------
3earA           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTGRGGRVVLLYGPRERRDVE
3buwB           ARLQKFIHKPIFRLSCTRLGQWAIGYVTADGNILQTIPHQALIDGFREGFYLFPDGRNQNPDLT------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
3eaqB           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTGRAGRGGRVVLLYGPRERR
149lA           NCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRLINMVFQMGETGVAGFTNSLRMLQQKR
3easA           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTGRARGGRVVLLYGPRERRD
3dofB           ----------------------------------------------------------------------
3cdrA           NCNGVITKDEAEKLFNQDVDARNAKLKPVYDSLDAVRQCALINMVFQMGETGVAGFTNSLRMLQQKRWDE
3b6eA           ----------------------------------------------------------------------
1dydA           NCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRLINMVFQMGETGVAGFTNSLRMLQQKR
3crvA           ENVPKLSKEELEI---------------------------------------------------------
3bxzA           IVAQAGYPAAVTIKADWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSGRQGDAGSSRFYLSMEDAL
2d7uA           VTVTGRRRGWFDINGATMLAVTMLDKYEAFGVTDYKLPRKAKEFIEEIEERV-----GVPVGLIKTGELE
3eaqA           RVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTGRAGGRVVLLYGPRERRDV
1d9zA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAIEGFLRSERSLIQTIGRAARNA-NGHVIMYADTITKS
3e0jC           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
1d9xA           EIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAIEGFLRSERSLIQTIGRAARNA-NGHVIMYADTITKS
1d9wA           NCNGVITKDEAEKLFNQDVDARNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQDRWDE
2d7dA           ----------------------------------------------------------------------
3dddA           LVADSPRVAEKILLKAFQLGAREIIIPEVNKDALELIKIFKPSQVTSCRRLGSKIEEKVDI---------
3c80A           ----------------------------------------------------------------------
3dzaA           KKLT----DDAAALLAADFVKTDAKAKIADRYVIINASIALSEDYVATPEKESAIQSANEKLAKGDQKGA
3dzaD           KKLT----DDAAALLAADFVKTDAKAKIADRYVIINASIALSEDYVATPEKESAIQSAEKLAKGDQKGAI
3cpeA           FHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVILPDIVMRYLVEYNECPVYIELNSTGVSVAK
2b99A           K----VCAHEASLGLMLAQLMTNKHIIE--VFVHEDEAKDDKELDWLAKRRAEEHAENVYYLLFKPEYLT
2bwxA           ALVEQMQPGSAALIFAAPEVTRSADSEYPYSDFWYFTGFNEPEAVLVLIKSDDTH--NHSVLFNRVRDLT
3dmqA           AAWFAEEDTGAQVLLCSEIGSEGRNFQFASHV--FDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKT
3dzaC           KKLT----DDAAALLAADFVKTDAKAKIADRYVIINASIALSEDYVATPEKESAIQSANEKLAKGDQKGA
2bwwA           ALVEQMQPGSAALIFAAPEVTRSADSEYPYRQFWYFTGFNEPEAVLVLIKSD--DTHNHSVLFNRVRDLT
2bwsA           ALVEQMQPGSAALIFAAPEVTRSADSEYPYRQFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAE
1a16A           ALVEQMQPGSAALIFAAPEVTRSADSEYPYRQFWYFTGFNEPEAVLVL--IKSDDTHNHSVLFNRVRDLT
1a1vA           IPTSGDVVVVATDALFTGDFDSVIDCNTVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIY
2bwvA           ALVEQMQPGSAALIFAAPEVTRSADSEYPNSDFWYFTGFNEPEAVLVLIKSD--DTHNHSVLFNRVRDLT
1az9-           ALVEQMQPGSAALIFAAPEVTRSADSEYPYRQFWYFTGFNEPEAVLVLIKSD--DTHNHSVLFNRVRDLT
2ekdA           IVSQLKDYPVINPVLGLHLILLGNTFENINVVKV----------SNYVGREERIAFYFVNRNVI------
1e2bA           ----------------------------------------------------------------------
2bhrB           KT----RTNDWDFVVTTDISEMGANFKAERPVILTDGEERHSSAAQRRGRVGRNPKNENDQYIYMGEPLE
3b94A           ----------------------------------------------------------------------
2bmfA           KT----RTNDWDFVVTTDISEMGANFKAERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEPLE
2bwyA           ALVEQMQPGSAALIFAAPEVTRSADSEYPYRDFWYFTGFNEPEAVLVLIKSD--DTHNHSVLFNRVRDLT
2dymE           ----------------------------------------------------------------------
2bwuA           ALVEQMQPGSAALIFAAPEVTRSADSEYPYRDFWYFTGFNEPEAVLVLIKSD--DTHNHSVLFNRVRDLT
2ekyB           ----------------------------------------------------------------------
1br9A           ---SLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQM-GCECKITRCPMIPISS
3b85B           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
1ekuA           KFFNSNKKKRFEKLTNYSVTDLNVQRKAIHELIQVMAE--------------------------------
2bwtA           ALVEQMQPGSAALIFAAPEVTRSADSEYPYRDFWYFTGFNEPEAVLVLIKSD--DTHNHSVLFNRVRDLT
1dxjA           SPASGDR---------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QWRRIERFTNNRIDASVIEGFEPRRSPKPRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
3eiqD           TLRDIETFYNTSI---------------------------------------------------------
2c5uA           GIISLYQGYDSQEKVCEIEQNFLKNYKK------------------------------------------
3crw1           RVMSR-----------------------------------------------------------------
2db3A           IAADLVKILEGSG---------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3eiqA           TLRDIETFYNTSIE--------------------------------------------------------
2bmfB           NDEDCAHWKEAKMLLDNINTPE------------------------------------------------
1d2mA           MQRAIEETNRRREAYNLEHGITPE----------------------------------------------
3dkpA           ----------------------------------------------------------------------
3dinA           LRIFGSEQIGKVMNILKIEEGQPIQHPM------------------------------------------
3berA           ----------------------------------------------------------------------
1c4oA           MQRAIEETNRRREAYNLEHGITPE----------------------------------------------
3eirB           ----------------------------------------------------------------------
1dhsA           -WGKIRVDAQPVK---------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
3eirA           ----------------------------------------------------------------------
1c69A           ----------------------------------------------------------------------
3earA           ALERAVGRRFKRVNPPTPEEVLEAK---------------------------------------------
3buwB           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
3eaqB           DVEALERAVGRRFKRVNPPTPEE-----------------------------------------------
149lA           WDEAAVNLAKSRWTPNRAKRVITTF---------------------------------------------
3easA           VEALERAVRFKRVNPPTPEEVLEAKWRH------------------------------------------
3dofB           ----------------------------------------------------------------------
3cdrA           AAVNLAKSRWYNQTPNRAKRVITTF---------------------------------------------
3b6eA           ----------------------------------------------------------------------
1dydA           WDEAALNLAKSRWYPNRAKRVITTF---------------------------------------------
3crvA           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2d7uA           HIIDRR----------------------------------------------------------------
3eaqA           --EALERAVGRRFKRVNPPTPEE-----------------------------------------------
1d9zA           MEIAIQETKRRRA---IQEEYNRKHGIVPRT---------------------------------------
3e0jC           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
1d9xA           MEIAIQETKRRRA---IQEEYNRKHGIVPRT---------------------------------------
1d9wA           AAVNLAKS-------RWYNQTPNRA---------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
3c80A           ----------------------------------------------------------------------
3dzaA           IDTLR-LAGIGVIENQYLP---------------------------------------------------
3dzaD           DTLRLA--GIGVIENQYLP---------------------------------------------------
3cpeA           SLYMDLEYEGVICDSYTDLG--------------------------------------------------
2b99A           RMAG------------------------------------------------------------------
2bwxA           AEIWFGRRLGQDA---------------------------------------------------------
3dmqA           AQSVLVRWYHEGL---------------------------------------------------------
3dzaC           IDTLRLAGIG------------------------------------------------------------
2bwwA           AEIWFGRRLGQDAAPEKLGVDRALAFSEIN----------------------------------------
2bwsA           IWFGRRLGQDAAPE--------------------------------------------------------
1a16A           AEIWFGRRLG------------------------------------------------------------
1a1vA           RFVAPGERPSGMFDS-------------------------------------------------------
2bwvA           AEIWFGRRLGQDAAPEKLGVDR------------------------------------------------
1az9-           AEIWFGRRLGQDAAPEKLGVDR------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           NDEDCAHWKEAKM---------------------------------------------------------
3b94A           ----------------------------------------------------------------------
2bmfA           NDEDCAHWKEAKMLLDNIN---------------------------------------------------
2bwyA           AEIWFGRR--------------------------------------------------------------
2dymE           ----------------------------------------------------------------------
2bwuA           AEIWFGRRLGQDA---------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
1br9A           PDECLWM---------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
1ekuA           ----------------------------------------------------------------------
2bwtA           AEIWFGR---------------------------------------------------------------
1dxjA           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3eirB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
3eirA           ----------------------------------------------------------------------
1c69A           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2d7uA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
3c80A           ----------------------------------------------------------------------
3dzaA           ----------------------------------------------------------------------
3dzaD           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
2bwxA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3dzaC           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2bwvA           ----------------------------------------------------------------------
1az9-           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
3b94A           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
2bwyA           ----------------------------------------------------------------------
2dymE           ----------------------------------------------------------------------
2bwuA           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
1br9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
1ekuA           ----------------------------------------------------------------------
2bwtA           ----------------------------------------------------------------------
1dxjA           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3bxzB           ----------------------------------------------------------------------
1cu1A           ----------------------------------------------------------------------
3eiqD           ----------------------------------------------------------------------
2c5uA           ----------------------------------------------------------------------
3crw1           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
2bhrA           ----------------------------------------------------------------------
1b47A           ----------------------------------------------------------------------
3eiqA           ----------------------------------------------------------------------
2bmfB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
3dkpA           ----------------------------------------------------------------------
3dinA           ----------------------------------------------------------------------
3berA           ----------------------------------------------------------------------
1c4oA           ----------------------------------------------------------------------
3eirB           ----------------------------------------------------------------------
1dhsA           ----------------------------------------------------------------------
3dwlD           ----------------------------------------------------------------------
3borA           ----------------------------------------------------------------------
3eirA           ----------------------------------------------------------------------
1c69A           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3buwB           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
149lA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
3cdrA           ----------------------------------------------------------------------
3b6eA           ----------------------------------------------------------------------
1dydA           ----------------------------------------------------------------------
3crvA           ----------------------------------------------------------------------
3bxzA           ----------------------------------------------------------------------
2d7uA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
3e0jC           ----------------------------------------------------------------------
2dgdA           ----------------------------------------------------------------------
3dl8A           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
1d9wA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3dddA           ----------------------------------------------------------------------
3c80A           ----------------------------------------------------------------------
3dzaA           ----------------------------------------------------------------------
3dzaD           ----------------------------------------------------------------------
3cpeA           ----------------------------------------------------------------------
2b99A           ----------------------------------------------------------------------
2bwxA           ----------------------------------------------------------------------
3dmqA           ----------------------------------------------------------------------
3dzaC           ----------------------------------------------------------------------
2bwwA           ----------------------------------------------------------------------
2bwsA           ----------------------------------------------------------------------
1a16A           ----------------------------------------------------------------------
1a1vA           ----------------------------------------------------------------------
2bwvA           ----------------------------------------------------------------------
1az9-           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------
1e2bA           ----------------------------------------------------------------------
2bhrB           ----------------------------------------------------------------------
3b94A           ----------------------------------------------------------------------
2bmfA           ----------------------------------------------------------------------
2bwyA           ----------------------------------------------------------------------
2dymE           ----------------------------------------------------------------------
2bwuA           ----------------------------------------------------------------------
2ekyB           ----------------------------------------------------------------------
1br9A           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
2dxcH           ----------------------------------------------------------------------
1ekuA           ----------------------------------------------------------------------
2bwtA           ----------------------------------------------------------------------
1dxjA           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
2ekdA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxx
3bxzB           ----
1cu1A           ----
3eiqD           ----
2c5uA           ----
3crw1           ----
2db3A           ----
2bhrA           ----
1b47A           ----
3eiqA           ----
2bmfB           ----
1d2mA           ----
3dkpA           ----
3dinA           ----
3berA           ----
1c4oA           ----
3eirB           ----
1dhsA           ----
3dwlD           ----
3borA           ----
3eirA           ----
1c69A           ----
3earA           ----
3buwB           ----
2b2nB           ----
2b2nA           ----
3eaqB           ----
149lA           ----
3easA           ----
3dofB           ----
3cdrA           ----
3b6eA           ----
1dydA           ----
3crvA           ----
3bxzA           ----
2d7uA           ----
3eaqA           ----
1d9zA           ----
3e0jC           ----
2dgdA           ----
3dl8A           ----
1d9xA           ----
1d9wA           ----
2d7dA           ----
3dddA           ----
3c80A           ----
3dzaA           ----
3dzaD           ----
3cpeA           ----
2b99A           ----
2bwxA           ----
3dmqA           ----
3dzaC           ----
2bwwA           ----
2bwsA           ----
1a16A           ----
1a1vA           ----
2bwvA           ----
1az9-           ----
2ekdA           ----
1e2bA           ----
2bhrB           ----
3b94A           ----
2bmfA           ----
2bwyA           ----
2dymE           ----
2bwuA           ----
2ekyB           ----
1br9A           ----
3b85B           ----
2dxcH           ----
1ekuA           ----
2bwtA           ----
1dxjA           ----
1eaqA           ----
2ekdA           ----