[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09446.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3eigA.bssp"
#ERROR : Can't open dsspfile "8dfrA.bssp"
#ERROR : Can't open dsspfile "1bozA.bssp"
#ERROR : Can't open dsspfile "1dlrA.bssp"
#ERROR : Can't open dsspfile "1dlsA.bssp"
#ERROR : Can't open dsspfile "3d80A.bssp"
#ERROR : Can't open dsspfile "3dfrA.bssp"
#ERROR : Can't open dsspfile "1ao8A.bssp"
#ERROR : Can't open dsspfile "3e0bA.bssp"
#ERROR : Can't open dsspfile "3datA.bssp"
#ERROR : Can't open dsspfile "1dhfA.bssp"
#ERROR : Can't open dsspfile "1cz3B.bssp"
#ERROR : Can't open dsspfile "3dgaA.bssp"
#ERROR : Can't open dsspfile "2blaA.bssp"
#ERROR : Can't open dsspfile "2blcA.bssp"
#ERROR : Can't open dsspfile "2blbA.bssp"
#ERROR : Can't open dsspfile "3dl6A.bssp"
#ERROR : Can't open dsspfile "1ai9A.bssp"
#ERROR : Can't open dsspfile "1cz3A.bssp"
#ERROR : Can't open dsspfile "3clbB.bssp"
#ERROR : Can't open dsspfile "2bl9A.bssp"
#ERROR : Can't open dsspfile "3cseA.bssp"
#ERROR : Can't open dsspfile "3dgaB.bssp"
#ERROR : Can't open dsspfile "3cl9A.bssp"
#ERROR : Can't open dsspfile "3dl5B.bssp"
#ERROR : Can't open dsspfile "3clbA.bssp"
#ERROR : Can't open dsspfile "3clbD.bssp"
#ERROR : Can't open dsspfile "3clbC.bssp"
#ERROR : Can't open dsspfile "2aznA.bssp"
#ERROR : Can't open dsspfile "3e43B.bssp"
#ERROR : Can't open dsspfile "3dl6B.bssp"
#ERROR : Can't open dsspfile "3dl5A.bssp"
#ERROR : Can't open dsspfile "3dl6E.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2cigA.bssp"
#ERROR : Can't open dsspfile "1dyrA.bssp"
#ERROR : Can't open dsspfile "4cd2A.bssp"
#ERROR : Can't open dsspfile "1df7A.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2d5gB.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"

## Summary of PDB Search
:166
    1e-53  38%  3eigA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-53  35%  8dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-53  38%  1bozA  [c.71.1] PROTEIN (DIHYDROFOLATE REDUCTASE)
    1e-51  38%  1dlrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-51  38%  1dlsA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-50  39%  3d80A  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-44  29%  3dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-43  28%  1ao8A  [c.71.1 (1ludA)] DIHYDROFOLATE REDUCTASE
    2e-42  49%  3e0bA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-35  50%  3datA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-34  38%  1dhfA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-34  28%  1cz3B  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-32  25%  3dgaA  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    7e-32  28%  2blaA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    2e-31  28%  2blcA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    3e-31  29%  2blbA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    3e-31  33%  3dl6A  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    6e-31  34%  1ai9A  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-30  28%  1cz3A  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-30  33%  3clbB  [x.x.x] DHFR-TS
    1e-29  29%  2bl9A  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    2e-29  29%  3cseA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-29  25%  3dgaB  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    3e-29  34%  3cl9A  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    4e-29  32%  3dl5B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-28  36%  3clbA  [x.x.x] DHFR-TS
    6e-28  33%  3clbD  [x.x.x] DHFR-TS
    1e-27  34%  3clbC  [x.x.x] DHFR-TS
    3e-27  13%  2aznA  [x.x.x] PUTATIVE 5-AMINO-6-(5-PHOSPHORIBOSYLAMINO)URACIL
    4e-27  11%  3e43B  [x.x.x] TYPE-2 RESTRICTION ENZYME HINDII
    2e-25  29%  3dl6B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    4e-25  31%  3dl5A  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-23  30%  3dl6E  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    4e-20  42%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-20  42%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-19  34%  2cigA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-19  39%  1dyrA  [c.71.1 (1e26A)] DIHYDROFOLATE REDUCTASE
    9e-17  41%  4cd2A  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-15  35%  1df7A  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-15  42%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    6e-15  41%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-13  42%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    5e-13  11%  2d5gB  [x.x.x] AXIN-1
    3e-11  41%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-11  40%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-10  41%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTLLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRRNIVVTRNRDL
3eigA           VGSLNCIVAVSQNMGIGKNGDLPWPLRNERRYFERMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
8dfrA           VRSLNSIVAVCQNMGIGKDGNLPWPLRNEYKYFQRMTSTSAVIMGKKTWFSINRPLKDRINIVLSRELKE
1bozA           VGSLNCIVAVSQNMGIGKNGDLPWPLRNEGRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1dlrA           VGSLNCIVAVSQNMGIGKNGDFPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1dlsA           VGSLNCIVAVSQNMGIGKNGDYPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
3d80A           VRPLNCIVAVSQNMGIGKNGDLPWPLRNEFKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
3dfrA           ----AFLWAQNRNGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPRPLPERTNVVLTHQEDY
1ao8A           ----AFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPRPLPERTNVVLTHQEDY
3e0bA           HMRVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3datA           ---VSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
1dhfA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFQRMTTTSSVIMGKKTWFSIPRPLKGRINLVLSRELKE
1cz3B           ---VIFVLAMDVSGKIASSV-ESWSSFEDRKNFRKITTEINVVMGRITFEEIGRPLPERLNVVLTRRPKT
3dgaA           EGKKNEVFNNYTFRGLGNKGVLPWKCNLDMKYFCAVTTYVVVVMGRTSWESIPKPLSNRINVILSRTLKD
2blaA           EGTKNEPFSPRTFRGLGNKGTLPWKCNVDMKYFRSVTTYVVVVMGRSNWESIPKPLPNRINVVLSKTLED
2blcA           EGTKNEPFSPRTFRGLGNKGTLPWKCNVDMKYFRSVTLQNVVVMGRSNWESIPKPLPNRINVVLSKTLTD
2blbA           ---KNEPFSPRTFRGLGNKGTLPWKCNVDMKYFSSVTTYVVVVMGRSSWESIPKPLPNRINVVLSKTLTD
3dl6A           -----VVAASVLSSGIGINGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGRPLKNRIIVVISSSLDE
1ai9A           KPNVAIIVAAKPALGIGYKGKMPWRLRKEIRYFKDVTTRTAVIMGRKTWESIFRPLPDRLNIILSRSYEN
1cz3A           ---VIFVLAMDVSGKIA-SSVESWSSFEDRKNFRKITTEINVVMGRITFEEIGRPLPERLNVVLTRRPKT
3clbB           LRAFSLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIFRPLPGRLNVVLSSTLTT
2bl9A           ---KNEPFSPRTFRGLGNKGTLPWKCNVDMKYFSSVTTYVVVVMGRSSWESIYKPLPNRINVVLSKTLTD
3cseA           VPVVGIVAALLPEMGIGFQGNLPWRLAKEMKYFREVTTQNVVIMGRKTWESIPRPLPKRINVVVSRSFDG
3dgaB           EGKKNEVFNNYTFRGLGNKGVLPWKCNLDMKYFCAVTTYVVVVMGRTSWESIPKPLSNRINVILSRTLKD
3cl9A           LRAFSLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTLTT
3dl5B           -----VVAASVLSSGIGINGQLPWSISEDLKFFSKITNNNALIMGRKTWDSIGRPLKNRIIVVISSSLDE
3clbA           LRAFSLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLRVVMGRKTWDSIFRPLPGRLNVVLSSTLTT
3clbD           LRAFSLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIFRPLPGRLNVVLSSTLTT
3clbC           LRAFSLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLRVVMGRKTWDSIPRPLPGRLNVVLSSTLTT
2aznA           ---YIISNVGTLDGKLTINNDSRISCEEDLIRVHKIRANVDGIVGIGTVLKDDIKSDRNPVRIVVDSKGV
3e43B           -------------------------------FIKPYQDINSILIGQKPFEKLVKFLKENLSDLTFKQYEY
3dl6B           -----VVAASVLSSGIGINGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGRPLKNRIIVVISSSLDE
3dl5A           -----VVAASVLSSGIGINGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGRPLKNRIIVVISSSLDE
3dl6E           -----VVAASVLSSGIGINGQLPWSISEDLKFFSKITNNNALIMGRKTWDSIGRPLKNRIIVVISSSLPQ
1dyhA           --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPG-
4dfrA           --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPG-
2cigA           --MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRVWDSLPAKVRPLPGRRNVVLSRQ
1dyrA           QKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVESMNVVLMGRKTWESIFRPLKGRINVVITRNESL
4cd2A           ---LTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVVVLMGRKTWESIFRPLKGRINVVITRNESL
1df7A           ------IWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGRRNVVLSRQ
3dauA           ----------AVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
1dhjA           --MISLIAALAVDRVIGMENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
2d0kA           ---ISLIAALAVDRVIGNENALPWNLPADLAWFKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPGT
2d5gB           ----------------------------------------------------------------------
1dhiA           ------------DRVIGMENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
2drcA           --MISLIAALAVDRVIGMENAMPFNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
1draA           --MISLIAALAVDRVIGMENAMPWNLPAELAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT


                         .         .         *         .         .         .         .:140
query           HIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDADVEGDAFFPAVDRTTWVETA
3eigA           PPQGAHFLSSLDDALKLANKVDMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLP
8dfrA           APKGAHYLSALLDSPELKSKVDMVWIVGGTAVYKAAMPINHRLFVTRILHEFESDTFFPEIDYKDFKLLT
1bozA           PPQGAHFLRSLDDALKLANKVDMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLP
1dlrA           PPQGAHFLRSLDDALKLANKVDMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLP
1dlsA           PPQGAHFLRSLDDALKLANKVDMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLP
3d80A           PPRGAHFLKSLDDALRLASKVDMVWIVGGSSVYQEAMPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLP
3dfrA           QAQGAVVVHDVAAAYAKQHLDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVS
1ao8A           QAQGAVVVHDVAAAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVS
3e0bA           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVF
3datA           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVF
1dhfA           PPQGAHFLRSLDDALKLTEKVDMVWIVGGSSVYKEAMNHHLKLFVTRIMQDFESDTFFPEIDLEKYKLLP
1cz3B           SNNPSLVFGSPADVVKFLKGYERVAVIGGKTVFTEFLKLVDELFVTVEPYVFKGIPFFDEFEGYFPLKLL
3dgaA           FDEDVYIINKVEDLIVLKLNYYKCFIIGGSVVYQEFLKLIKKIYFTRINSTYECDVFFPEINENEYQIIS
2blaA           VKEKVFIIDSIDDLLLLLLKYYKCFIIGGAQVYRECLNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTS
2blcA           VKEKVFIIDSIDDLLLLLLKYYKCFIIGGAQVYRECLSRIKQIYFTRINGAYPCDVFFPEFDESEFRVTS
2blbA           VKEKVFIIDSIDDLLLLLLKYYKCFIIGGAQVYRECLNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTS
3dl6A           ADPNVVVFRNLEDSIENLMSIENIFVCGGESIYRDALNFVDRIYLTRVALEDEFDTYFPEIPETFLPVYM
1ai9A           EIIDDNIISSIESSLNLVSDVERVFIIGGAEIYNELISLVSHLLITEIEESIEMDTFLKF-PLESWTKQP
1cz3A           SNNPSFFNGSPADVVKFLKGYERVAVIGGKTVFTEFLKLVDELFVTVEPYVFKGIPFFDEFEGYFPLKLL
3clbB           QDSIVAVNGGLEQALQLTPSIETVYCIGGGSVYAEALRPPQAIYRTTIRASESCSVFFRVPESGTEAAAG
2bl9A           VKEKVFIIDSIDDLLLLLLKYYKCFIIGGAQVYRECLNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTS
3cseA           ELDGIYHSNSLRNCSSLANKIERIYIIGGGEIYRQSMDLADHWLITKIMPLPETDTFLQKQELEQRFYDN
3dgaB           FDEDVYIINKVEDLIVLKLNYYKCFIIGGSVVYQEFLKLIKKIYFTRINSTYECDVFFPEINENEYQIIS
3cl9A           ADSIVAVNGGLEQALQLTPSIETVYCIGGGSVYAEALRPLQAIYRTTIRASESCSVFFRVPESGTEAAAG
3dl5B           ADPNVVVFRNLEDSIENDDSIENIFVCGGESIYRDALNFVDRIYLTRVAEDIEFDTYFPEIPETFLPVYM
3clbA           ADSIVAVNGGLEQALQLTPSIETVYCIGGGSVYAEALRPLQAIYRTTIRASESSCSVFFRVPESGTEAAA
3clbD           QHSIVAVNGGLEQALQLTPSIETVYCIGGGSVYAEALRPLQAIYRTTIRAESSCSVFFRVPESGTEAAAG
3clbC           QHLLDGVNGGLEQALQLTPSIETVYCIGGGSVYAEALRPLQAIYRTTIRASESSCSVFFRVPESGTEAAA
2aznA           EVVKCGRGKVDLKKLDIDKGIKSILLEGGGTLNWGFKGLVDEVSVYIAPKIFGGKEAPTYVDGEGFKTVD
3e43B           LNDLFKLFNSPTLLFLLSNWSIENLFEEKQNDTADILLVKDQFYLLDVKRNISKSAFAPNII-SAYKLAQ
3dl6B           ADPNVVVFRNLEDSIENDDSIENIFVCGGESIYRDALNFVDRIYLTRVALEDIEFDTYFPEIPETFLPVY
3dl5A           ADPNVVVFRNLEDSIENDDSIENIFVCGGESIYRDALNFVDRIYLTRVALEDEFDTYFPEIPETFLPVYM
3dl6E           DEANVVVFRNLEDSLMNDDSIENIFVCGGESIYRDALNFVDRIYLTRVALDIEFDTYFPEIPETFLPVYM
1dyhA           TDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
4dfrA           TDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
2cigA           ADFMASGAEVVGSLEE-ALTSPETWVIGGGQVYALALPYATRTEVDIGLPREAGDALAPVLDETWRGETG
1dyrA           DKSLDHALELLYRTSESSVQINRIFVIGGAQLYKAAMPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSV
4cd2A           GIHSAKSLDHALEGSESSVQINRIFVIGGAQLYKAAMPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSV
1df7A           ADFMASGAEVVGSLEE-ALTSPETWVIGGGQVYALALPYATRCEVDIGLPREAGDALAPVLDETWRGETG
3dauA           DDRVTWVK-SVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
1dhjA           DD-RVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVS
2d0kA           DD-RVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
2d5gB           --DSIVVAYYFCGEP----IPYETLVRGRAVTLGQTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPV
1dhiA           DD-RVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
2drcA           DDRVTWVKSVDEAIAACGD-VPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
1draA           DDRVTWVK-SVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF


                         +         .         .         .         .         *         .:210
query           RELHHSETNGFDYAFVTYERPASxxx
3eigA           EYPGVLEEKGIKYKFEVYEK------
8dfrA           EYPGVPEEDGIQYKFEVYQK------
1bozA           EYPGVLEEKGIKYKFEVYEK------
1dlrA           EYPGVLEEKGIKYKFEVYEK------
1dlsA           EYPGVLEEKGIKYKFEVYEK------
3d80A           EYPGVQEEKGIKYKFEVYEK------
3dfrA           SRTVEDTNPALTHTYEVWQK------
1ao8A           SRTVEDTNPALTHTYEVWQK------
3e0bA           VEKGLTEKNPYTYYYHVYEK------
3datA           VEKGLTEKNPYTYYYHVYEK------
1dhfA           EYPGVLEEKGIKYKFEVYEK------
1cz3B           EMRRLNERGTLFLKYSVEKS------
3dgaA           VS-DVYTSNNTTLDFIIYKK------
2blaA           VS-EVYNSKGTTLDFLVYSK------
2blcA           VS-EVYNSKGTTLDFLVYSK------
2blbA           VS-EVYNSKGTTLDFLVYSK------
3dl6A           SQTF--CTKNISYDFMIFEK------
1ai9A           KSELQKKEGDFTYNYTLWTR------
1cz3A           EMRRLNERGTLFLKYS----------
3clbB           IEWQRETISEELTSANGNETK-----
2bl9A           VS-EVYNSKGTTLDFLVYSK------
3cseA           SD------KLVDFLPSSIQLE-----
3dgaB           VSDVYTS-NNTTLDFIIYKK------
3cl9A           IE-WQRETISEELTSANGNE------
3dl5B           SQTFCTKNISYDFMIFEKQE------
3clbA           GIEWQRET------------------
3clbD           IEWQRETISEELTSANGNETK-----
3clbC           GIEWQRETISEELTS-----------
2aznA           ECVKKNFYRLGEGIVLEFKV------
3e43B           TCAKMIDNEFDLFDINYLEVD-----
3dl6B           MSQTFCTKNISYDFMIFE--------
3dl5A           SQTFCTKNISYDFMIFEKQEK-----
3dl6E           SQTFCTKNISYDFMIFEKQEKLK---
1dyhA           SEFHDADANSHSYCFEILER------
4dfrA           SEFHDADANSHSYCFKILER------
2cigA           EW--RFSRSGLRYRLYSYHR------
1dyrA           WKKEKINEDGFDYEFEMWTR------
4cd2A           WKKEKINEDGFDYEFEMWTR------
1df7A           EW--RFSRSGLRYRLYSYHR------
3dauA           SEFHDADANSHSYCFEILER------
1dhjA           SEFHDADANSHSYCFEILER------
2d0kA           SEFHDADANSHSYSFEILER------
2d5gB           FEEKIGKVEKVD--------------
1dhiA           SEFHDADANSHSYCFEILER------
2drcA           SEFHDADANSHSYCFEILER------
1draA           SEFHDADANSHSYCFEILER------