[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09628.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bsyA.bssp"
#ERROR : Can't open dsspfile "3ehwB.bssp"
#ERROR : Can't open dsspfile "3ehwA.bssp"
#ERROR : Can't open dsspfile "3c3iB.bssp"
#ERROR : Can't open dsspfile "1dunA.bssp"
#ERROR : Can't open dsspfile "2bazA.bssp"
#ERROR : Can't open dsspfile "1ducA.bssp"
#ERROR : Can't open dsspfile "1dupA.bssp"
#ERROR : Can't open dsspfile "3c3iD.bssp"
#ERROR : Can't open dsspfile "3c3iA.bssp"
#ERROR : Can't open dsspfile "3c2tB.bssp"
#ERROR : Can't open dsspfile "3ecyA.bssp"
#ERROR : Can't open dsspfile "3ca9B.bssp"
#ERROR : Can't open dsspfile "2d4mA.bssp"
#ERROR : Can't open dsspfile "3c2tA.bssp"
#ERROR : Can't open dsspfile "2d4lA.bssp"
#ERROR : Can't open dsspfile "3ca9A.bssp"
#ERROR : Can't open dsspfile "2d4nA.bssp"
#ERROR : Can't open dsspfile "1dutA.bssp"
#ERROR : Can't open dsspfile "2bt1A.bssp"
#ERROR : Can't open dsspfile "2cb0A.bssp"
#ERROR : Can't open dsspfile "2cb0B.bssp"

## Summary of PDB Search
:188
    5e-36  13%  2bsyA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    5e-32  17%  3ehwB  [x.x.x] DUTP PYROPHOSPHATASE
    9e-31  17%  3ehwA  [x.x.x] DUTP PYROPHOSPHATASE
    5e-29  19%  3c3iB  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    4e-27  16%  1dunA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEODITOHYDROLASE
    6e-27  14%  2bazA  [x.x.x] HYPOTHETICAL PROTEIN BSU20020
    2e-26  17%  1ducA  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEODITOHYDROLASE
    1e-25  20%  1dupA  [b.85.4] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    2e-25  17%  3c3iD  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-25  18%  3c3iA  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    6e-25  19%  3c2tB  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    4e-24  10%  3ecyA  [x.x.x] CG4584-PA, ISOFORM A (BCDNA.LD08534)
    1e-22  20%  3ca9B  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    1e-22  14%  2d4mA  [x.x.x] DU
    2e-22  19%  3c2tA  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    3e-22  14%  2d4lA  [x.x.x] DU
    8e-22  20%  3ca9A  [x.x.x] DEOXYURIDINE TRIPHOSPHATASE
    1e-21  15%  2d4nA  [x.x.x] DU
    3e-20  16%  1dutA  [b.85.4] DUTP PYROPHOSPHATASE
    9e-12  12%  2bt1A  [x.x.x] DEOXYURIDINE 5'-TRIPHOSPHATE NUCLEOTIDOHYDROLASE
    6e-05  13%  2cb0A  [x.x.x] GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE
    6e-05  13%  2cb0B  [x.x.x] GLUCOSAMINE-FRUCTOSE-6-PHOSPHATE
:188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxIKSDKWIRRMAEQHGMIEPFEPGQVRESDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
2bsyA           --MLWGSTSRPVTSHVGIIDPGYTGELRLILQNQRRYNSTLRPSELKIHLAAFRYATPQMGPINHPQYPG
3ehwB           ---------------------------------------------------QLRFARLSEHATAPTRGSA
3ehwA           ---------------------------------------------------QLRFARLSEHATAPTRGSA
3c3iB           ------------------------------------------------------LVKKLVESATTPMRGS
1dunA           ---------------------------------------------------------AYQGTQIKEKRDE
2bazA           ---------------------------------------------------QIKIKYLDETQTRINKMEQ
1ducA           -----------------------------------------------------------QGTQIKEKRDE
1dupA           ------------------------------------------KILDPRVGKEFPLPTYAT---SGSAGLD
3c3iD           ------------------------------------------------------LVKKLVESATTPMRGS
3c3iA           ------------------------------------------------------LVKKLVESATTPMRGS
3c2tB           ------------------------------------------------------LVKKLVESATTPMRGS
3ecyA           ---------------------------------------------------VLRFAKLTENALEPVRGSA
3ca9B           ------------------------------------------------------LVKKLVESATTPMRGS
2d4mA           -----------------------------------------------------------QPISKLTRATP
3c2tA           ------------------------------------------------------LVKKLVESATTPMGSE
2d4lA           -----------------------------------------------------------QPISKLTRATP
3ca9A           -------------------------------------------------------VKKLVESATTPMRGS
2d4nA           -------------------------------------------------------------PISKLTRAT
1dutA           -----------------------------------------------------------GDGILDKRSED
2bt1A           -----------------------------------------------------HIRYAFQNDKLLLQQAS
2cb0A           ------------------------------LPRRILYLGCGSSHFLAKLLAVTNHGGTGVALPCSEFLYS
2cb0B           ------------------------------LPRRILYLGCGSSHFLAKLLAVTNHGGTGVALPCSEFLYS


                         .         .         *         .         .         .         .:140
query           EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
2bsyA           DVGLDVSLPKDLALFPHQTVSVTLTVPPPSIPHHRPTIFGRSGLAMQGILVKPC---RWRRGGVDVSLTN
3ehwB           RAAGYDLYAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAHFIDVGAGVIDEDYRGNVGVVLFN
3ehwA           RAAGYDLYAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAHFIDVGAGVIDEDYRGNVGVVLFN
3c3iB           EGAGYDISSVEVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAKYGIDVLAGVIDSDYRGEVKVILYN
1dunA           DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMAKQGLLINGGIIDEGYTGEIQVICTN
2bazA           GDWIDLRAAEDVAIKKDEFKLVPLGVAMELPEGYEAHVVPRSSTYNFGVIQTNSMIDESYKGDNDFWFPA
1ducA           DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMAKQGLLINGGIIDEGYTGEIQVICTN
1dupA           LRACLN---DAVELAPGDTTLVPTGLAIHIADPLAAMMLPRSGLGHKHGIVLGNLVDSDYQGQLMISVWN
3c3iD           EGAGYDISSVEVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAKYGIDVLAGVIDSDYRGEVKVILYN
3c3iA           EGAYDISSVEDVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAKYGIDVLAGVIDSDYRGEVKVILYN
3c2tB           EGAGYDISSVEVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAKYGIDVLAGVIDEDYTGEVKVILYN
3ecyA           KAAGVDLRSAYVVVPARGKAIVKTDLQVQVPEGSYGRVAPRFIDVGAGVV------DEDYRGNLGVVLFN
3ca9B           EGAGYDISSVEVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAKYGIDVLAGVIDEDYTGEVKVILYN
2d4mA           GSAGLDLSTSHVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSITMKGLQVYPGVIDNDYTGEIKIMAKA
3c2tA           GAAGYDISSVEVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAKYGIDVLAGVIDEDYTGEVKVILYN
2d4lA           GSAGLDLSTSHVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSITMKGLQVYPGVIDNDYTGEIKIMAKA
3ca9A           EGAGYDISSVEVVVPAMGRIAVSTGISIRVPDGTYGRIAPRSGLAKYGIDVLAGVIDEDYTGEVKVILYN
2d4nA           PGSALCSTSHTVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSITMKGLQVYPGVIDNDYTGEIKIMAKA
1dutA           --AGYDLLAAKIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIGSKGLDVLGGVIDEGYRGEIGVIMIN
2bt1A           VGRLTLVNKTTILLRPMKTTTVDLGLYARPPEGHGLMLWGST---SRPVTSHVGIIDPGYTGELRLILQN
2cb0A           KEAYPIGKPELVVGISRSGETTEVLLALEKINTKLGISAYESSLTRACDYSLVVPTIEESVV----THSF
2cb0B           KEAYPIGKPELVVGISRSGETTEVLLALEKINTKLGISAYESSLTRACDYSLVVPTIEE-----------


                         +         .         .         .         .         *         .:210
query           TTPLPAKIYAGEGCAQVLFFESDEICETSYADRGGKYQGQQGVTxxxx
2bsyA           FSDQTVFLNKYRRFCQLVYLHKHHLTSFYSPHSDAGVLGPRSLF----
3ehwB           FGKEKFEVKKGDRIAQLICEEIEEVQALDDTERGSGGFGSTGK-----
3ehwA           FGKEKFEVKKGDRIAQLICEEIEEVQALDDTERGSGGFGSTGK-----
3c3iB           TTERDYIIKKGDRIAQLILEQIVTPGVAVVLDLSDTARGSGG------
1dunA           IGKSNIKLIEGQKFAQLIILQHHSNSRQPWDEN---------------
2bazA           YALRDTKIKKGDRICQFRIMKKMPAVD---------------------
1ducA           IGKSNIKLIEGQKFAQLIILQHHSNSRQPWDE----------------
1dupA           RGQDSFTIQPGERIAQMIFVVQAEFNLVE-------------------
3c3iD           TTERDYIIKKGDRIAQLILEQIVTPGVAVV---LDLSDTA--------
3c3iA           TTERDYIIKKGDRIAQLILEQIVTPGVAVVLDL---------------
3c2tB           TTERDYIIKKGDRIAQLILEVTPGVAV---------------------
3ecyA           HSDVDFEVKHGDRIAQFICERIFYPQLVMVDK----------------
3ca9B           TTERDYIIKKGDRIAQLILE----------------------------
2d4mA           VNN-IVTVSQGNRIAQLILLP---------------------------
3c2tA           TTERDYIIKKGDRIAQLILE----------------------------
2d4lA           VNN-IVTVSQGNRIAQLILLP---------------------------
3ca9A           TTERDYIIKKGDRIAQLILE----------------------------
2d4nA           VNN-IVTVSQGNRIAQLILLP---------------------------
1dutA           VSRKSITLMERQKIAQLIILP---------------------------
2bt1A           QRRYNSTLRPSELK----------------------------------
2cb0A           TAFYFAYLQLLRHSYGLPLLEATEVAKAT-------------------
2cb0B           ------------------------------------------------