[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09694.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ckyC.bssp"
#ERROR : Can't open dsspfile "2cvzA.bssp"
#ERROR : Can't open dsspfile "3ckyD.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "3ckyA.bssp"
#ERROR : Can't open dsspfile "1dljA.bssp"
#ERROR : Can't open dsspfile "1dliA.bssp"
#ERROR : Can't open dsspfile "3cumA.bssp"
#ERROR : Can't open dsspfile "3ckyB.bssp"
#ERROR : Can't open dsspfile "2dpoA.bssp"
#ERROR : Can't open dsspfile "3dzbA.bssp"
#ERROR : Can't open dsspfile "3c39B.bssp"
#ERROR : Can't open dsspfile "3dzbB.bssp"
#ERROR : Can't open dsspfile "3egoA.bssp"
#ERROR : Can't open dsspfile "3egoB.bssp"
#ERROR : Can't open dsspfile "1bg6A.bssp"
#ERROR : Can't open dsspfile "3c24A.bssp"
#ERROR : Can't open dsspfile "3dc2B.bssp"
#ERROR : Can't open dsspfile "2amfC.bssp"
#ERROR : Can't open dsspfile "2amfA.bssp"
#ERROR : Can't open dsspfile "1dxyA.bssp"
#ERROR : Can't open dsspfile "2amfE.bssp"
#ERROR : Can't open dsspfile "2d5cA.bssp"
#ERROR : Can't open dsspfile "2ahrC.bssp"
#ERROR : Can't open dsspfile "2ahrA.bssp"
#ERROR : Can't open dsspfile "2amfD.bssp"
#ERROR : Can't open dsspfile "3ddnB.bssp"
#ERROR : Can't open dsspfile "2cy0B.bssp"
#ERROR : Can't open dsspfile "2cy0A.bssp"
#ERROR : Can't open dsspfile "2b0jA.bssp"
#ERROR : Can't open dsspfile "2ahrD.bssp"
#ERROR : Can't open dsspfile "3dafA.bssp"
#ERROR : Can't open dsspfile "2ahrE.bssp"
#ERROR : Can't open dsspfile "3c7aA.bssp"
#ERROR : Can't open dsspfile "3c24B.bssp"
#ERROR : Can't open dsspfile "148lE.bssp"
#ERROR : Can't open dsspfile "3dc2A.bssp"
#ERROR : Can't open dsspfile "2dbqA.bssp"
#ERROR : Can't open dsspfile "3d1lB.bssp"
#ERROR : Can't open dsspfile "2d5cB.bssp"
#ERROR : Can't open dsspfile "3dttA.bssp"
#ERROR : Can't open dsspfile "2d0iA.bssp"
#ERROR : Can't open dsspfile "3d1lA.bssp"
#ERROR : Can't open dsspfile "3c7dB.bssp"
#ERROR : Can't open dsspfile "2dbrA.bssp"
#ERROR : Can't open dsspfile "3dttB.bssp"
#ERROR : Can't open dsspfile "1e5lA.bssp"
#ERROR : Can't open dsspfile "3btvB.bssp"
#ERROR : Can't open dsspfile "3btvA.bssp"
#ERROR : Can't open dsspfile "2eklA.bssp"
#ERROR : Can't open dsspfile "2d4aB.bssp"
#ERROR : Can't open dsspfile "3cmmC.bssp"
#ERROR : Can't open dsspfile "2d4aA.bssp"
#ERROR : Can't open dsspfile "3btuB.bssp"
#ERROR : Can't open dsspfile "3db2B.bssp"
#ERROR : Can't open dsspfile "3c1oA.bssp"
#ERROR : Can't open dsspfile "2aejB.bssp"
#ERROR : Can't open dsspfile "3db2C.bssp"
#ERROR : Can't open dsspfile "3cdqA.bssp"
#ERROR : Can't open dsspfile "2aemA.bssp"
#ERROR : Can't open dsspfile "3e82E.bssp"
#ERROR : Can't open dsspfile "2d4aC.bssp"
#ERROR : Can't open dsspfile "2aefB.bssp"
#ERROR : Can't open dsspfile "2eggB.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "3btuE.bssp"
#ERROR : Can't open dsspfile "3btsA.bssp"
#ERROR : Can't open dsspfile "3btsB.bssp"
#ERROR : Can't open dsspfile "2csuB.bssp"

## Summary of PDB Search
:289
    2e-70  35%  3ckyC  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    6e-42  31%  2cvzA  [c.2.1 - a.100.1 (1j3vA)] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    1e-35  34%  3ckyD  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    5e-35  23%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    3e-34  35%  3ckyA  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    8e-33  14%  1dljA  [c.2.1 - a.100.1 - c.26.3] UDP-GLUCOSE DEHYDROGENASE
    3e-32  14%  1dliA  [c.2.1 - a.100.1 - c.26.3] UDP-GLUCOSE DEHYDROGENASE
    1e-31  34%  3cumA  [x.x.x] PROBABLE 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    1e-30  35%  3ckyB  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    2e-23  14%  2dpoA  [x.x.x] L-GULONATE 3-DEHYDROGENASE
    5e-23  12%  3dzbA  [x.x.x] PREPHENATE DEHYDROGENASE
    2e-22   7%  3c39B  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    2e-21  12%  3dzbB  [x.x.x] PREPHENATE DEHYDROGENASE
    5e-21  12%  3egoA  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    8e-20  12%  3egoB  [x.x.x] PROBABLE 2-DEHYDROPANTOATE 2-REDUCTASE
    3e-19  11%  1bg6A  [x.x.x] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    2e-18  16%  3c24A  [x.x.x] PUTATIVE OXIDOREDUCTASE
    2e-18  15%  3dc2B  [x.x.x] D-3-PHOSPHOGLYCERATE DEHYDROGENASE
    2e-18  14%  2amfC  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    2e-18  13%  2amfA  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    3e-18  13%  1dxyA  [x.x.x] D-2-HYDROXYISOCAPROATE DEHYDROGENASE
    1e-17  12%  2amfE  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    1e-17  16%  2d5cA  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    2e-17  13%  2ahrC  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    2e-17  13%  2ahrA  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    7e-17  14%  2amfD  [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
    1e-16  15%  3ddnB  [x.x.x] D-3-PHOSPHOGLYCERATE DEHYDROGENASE
    2e-16  17%  2cy0B  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    2e-16  16%  2cy0A  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    7e-16  11%  2b0jA  [x.x.x] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
    9e-16  13%  2ahrD  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    2e-15  12%  3dafA  [x.x.x] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
    6e-15  12%  2ahrE  [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
    4e-14   8%  3c7aA  [x.x.x] OCTOPINE DEHYDROGENASE
    5e-14  16%  3c24B  [x.x.x] PUTATIVE OXIDOREDUCTASE
    5e-14   9%  148lE  [d.2.1] T4 LYSOZYME
    6e-14  13%  3dc2A  [x.x.x] D-3-PHOSPHOGLYCERATE DEHYDROGENASE
    1e-13  12%  2dbqA  [x.x.x] GLYOXYLATE REDUCTASE
    1e-13  12%  3d1lB  [x.x.x] PUTATIVE NADP OXIDOREDUCTASE BF3122
    3e-13  19%  2d5cB  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    3e-13  15%  3dttA  [x.x.x] NADP OXIDOREDUCTASE
    3e-13  12%  2d0iA  [x.x.x] DEHYDROGENASE
    1e-12  12%  3d1lA  [x.x.x] PUTATIVE NADP OXIDOREDUCTASE BF3122
    1e-12   9%  3c7dB  [x.x.x] OCTOPINE DEHYDROGENASE
    2e-12  12%  2dbrA  [x.x.x] GLYOXYLATE REDUCTASE
    8e-12  13%  3dttB  [x.x.x] NADP OXIDOREDUCTASE
    3e-11  12%  1e5lA  [c.2.1 - d.81.1] SACCHAROPINE REDUCTASE
    2e-10   7%  3btvB  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-10  10%  3btvA  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-09  17%  2eklA  [x.x.x] D-3-PHOSPHOGLYCERATE DEHYDROGENASE
    6e-07  14%  2d4aB  [x.x.x] MALATE DEHYDROGENASE
    1e-06  15%  3cmmC  [x.x.x] UBIQUITIN-ACTIVATING ENZYME E1 1
    2e-06  13%  2d4aA  [x.x.x] MALATE DEHYDROGENASE
    4e-06   9%  3btuB  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    1e-05  14%  3db2B  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    3e-05  16%  3c1oA  [x.x.x] EUGENOL SYNTHASE
    5e-05  12%  2aejB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    6e-05  14%  3db2C  [x.x.x] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE
    9e-05   7%  3cdqA  [x.x.x] LYSOZYME
    1e-04  12%  2aemA  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    2e-04  15%  3e82E  [x.x.x] PUTATIVE OXIDOREDUCTASE
    3e-04  13%  2d4aC  [x.x.x] MALATE DEHYDROGENASE
    5e-04   9%  2aefB  [x.x.x] CALCIUM-GATED POTASSIUM CHANNEL MTHK
    5e-04   8%  2eggB  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    5e-04  14%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    7e-04  11%  3btuE  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-04  15%  3btsA  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-04  16%  3btsB  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-04  14%  2csuB  [x.x.x] 457AA LONG HYPOTHETICAL PROTEIN
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAVVFTNVTSSED
3ckyC           ---IGFIGLGAMGKPMAINLLKEGVTVYAFDLMEANVAAVVAQGAQACENNQKVAAASDIIFTSLPNAGI
2cvzA           --KVAFIGLG-AGYPAG--HLARRFPTLVWNRTFEKALRHQEEFGS-EAVPLERVAEARVIFTCLPTTRE
3ckyD           -------------------------------------------------GAQKVAAASDIIFTSLPNAGI
3dojA           MMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCA
3ckyA           --KIGFIGLGAMGKPMAINLLKEGVTVYAFDLMEANVAAVVAQGAQACENNQKVAAASDIIFTSLPNAGI
1dljA           --------TIVDILPSKVDKINNGLSPIQDEYIEYYLKSKQL-SIKATLDSKAAYKEAELVIIATPTNYN
1dliA           --------TIVDILPSKVDKINNGLSP-IQDEYIEYYLKSKQLSIKATLDSKAAYKEAELVIIATPTNYN
3cumA           --QIAFIGLGHGAPATNLLKAGYLLNV--FDLVQSAVDGLVAAGASAARSARDAVQGADVVISLPASQHV
3ckyB           --KIGFIGLGAMGKPMAINLLKEGVTVYAFDLMEANVAAVVAQGAQACENNQKVAAASDIIFTSLPNAGI
2dpoA           ---VLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIRKEMKSLAEAVEGVVHIQECVPENLD
3dzbA           --TIYIAGLGLIGGSLALGRDHPDYEILGYNRSDYSRNIALERGIVDRATGKEFAPLADVIILAVPI-KQ
3c39B           ASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQYFAKALESPERPFLAILGGAK
3dzbB           --TIYIAGLGLIGGSLALGRDHPDYEILGYNRSDYSRNIALERGIVDRATGKEFAPLADVIIL-AVPIKQ
3egoA           ---IGIIGGGSVGLLCAYYLSL-YHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDL
3egoB           ---IGIIGGGSVGLLCAYYL-SLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDL
1bg6A           --TYAVLGLGNGGHAFAAYLALKGQSVLAWDIDAQRIKEIQDRGAIIAEGPGLAGTAHPDLLTLIILNPG
3c24A           --TVAILGAGGKGARITRKIHDSAHHLAAIEIAPEGRDRLQGGIPLTDGDGWIDEADVVVLALPDNIIEK
3dc2B           --TVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAAQ--LGIELLSLDDLLARADFISVHLPKTPE
2amfC           --KIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQL
2amfA           --KIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQL
1dxyA           --TVGVMGTGHIGQVAIKLFKGFGAKVIAYDPYPMKGDHPDFDYV----SLEDLFKQSDVIDLHVPGIEQ
2amfE           AMKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQL
2d5cA           ------LGAGGAGRAVAFALREAGLEVWVWNRTPQRALALAEEFGL-RAVPLEKAREARLLVNATRVGLE
2ahrC           ---IGIIGVGKASA-IIKGLKQTPHELIISGSSLERSKEIAEQLALPYASHQDLIDQVDLVI--------
2ahrA           --KIGIIGVGKASA-IIKGLKQTPHELIISGSSLERSKEIAEQLALPYASHQDLIDQVDLVILGIKP---
2amfD           AMKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQL
3ddnB           --TVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAAQ--LGIELLSLDDLLARADFISVHLPKTPE
2cy0B           ------LGAGGAGRAVAFALREAGLEVWVWNRTPQRALALAEEFGL-RAVPLEKAREARLLVNATRVGLE
2cy0A           ------LGAGGAGRAVAFALREAGLEVWVWNRTPQRALALAEEFGLRA-VPLEKAREARLLVNATRVGLE
2b0jA           ---------------------------------------PEDVGLKVTSDDREAVEGADIVITWLPKGNK
2ahrD           --KIGIIGVGKASA-IIKGLKQTPHELIISGSSLERSKEIAEQLALPYASHQDLIDQVDLVI--------
3dafA           ----------------------------------IHLVHPEDVGLKVTSDDREAVEGADIVITWLPKGNK
2ahrE           --KIGIIGVGKASA-IIKGLKQTPHELIISGSSLERSKEIAEQLALPYASHQDLIDQVDLVILGIKPQLF
3c7aA           --KVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTTVIVNEKDGTQTEVKSRPKVITKDPEIA
3c24B           --TVAILGAGGKGARITRKIHDSAHHLAAIEIAPEGRDRLQGGIP---LTDGDGWIDEADVVVLALPDNI
148lE           --GYYEIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVIT----KDEAEKLFNQDVDAAVRGILRNAKLKP
3dc2A           --TVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAAQ--LGIELLSLDDLLARADFISVHLPKTPE
2dbqA           --TIGIIGLGRIGQAIAKRAKGFNRILYYSRTRKEEVERELNAEFK---PLEDLLRESDFVVLAVPLTRE
3d1lB           -TPIVLIGAGNLATNLAKALYRKGFRIVQVYSRTEESARELAQKVEAEYTTDLAEVNPYAKLYIVSLKDS
2d5cB           ------LGAGGAGRAVAFALREAGLEVWVWNRTPQRALALAEEFGLRA-VPLEKAREARLLVNATRVGLA
3dttA           ---IAVLGTGTVGRTAGALADLGHEVTIGTRDPKPFSQWLPEHPHVHLAAFADVAAGAELVVNATEGASS
2d0iA           --KVGILGMGAIGKAIARRLIPFGVKLYYWSRHRKVNVEKE--LKARYMDIDELLEKSDIVILALPLTRD
3d1lA           -TPIVLIGAGNLATNLAKALYRKGFRIVQVYSRTEESAREQKVEAEYTTDLAEVNPYA-----------K
3c7dB           --KVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFAGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFA
2dbrA           --TIGIIGLGRIGQAIAKRAKGFNMRILYYSRTRKEEVERE--LNAEFKPLEDLLRESDFVVLAVPLTRE
3dttB           ---IAVLGTGTVGRTAGALADLGHEVTIGTRDPKATLARAEPPPFSQLAAFADVAAGAELVVNATEGASS
1e5lA           --SVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDAEVAKHDLV
3btvB           ---VGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIAPTLESFASSSTIDMIVIAIQVASH
3btvA           ---VGFVGLNAAKGWAIKTHYPAILQLSSQFQTSIATIQRLKLSNATAFPTLESFASSSTIDMIVIQVAS
2eklA           --TIGIVGFGRIGTKVGIIANAMGMKVLAYDILDIREKAEK--INAKAVSLEELLKNSDVISLHVTVSKD
2d4aB           ---ITILGAGKVGMATAVMLMMRGYDDLLLIARTPGKPQGEVDIRISGSNSYEDMRGSDIVLVTAGIGEQ
3cmmC           --NVLILGLKGLGVEIAKNVVLAGVKSMTVFDPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELN--AY
2d4aA           ---ITILGAGKVGMATAVMLMMRGYDDLLLIARTPGKPQGEALIRISGSNSYEDMRGSDIVLVTAGIGLL
3btuB           PIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSST
3db2B           PVGVAAIGLGRWAYVADAYTKSEKLKLVTCYSRTEDKREKFGKRYNCAGDATEALLAREDVEVIITVPND
3c1oA           EKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSTPSSVQLREEFR----SMGVTIIEGEMEEHEK
2aejB           --HVVICGWSESTLECLRELRGSEVFVLAEDENVR---------------KKVLRSGANFVHGDPTRVSD
3db2C           --GVAAIGLGRWAYVADAYTKSEKLKVTCYSRTEDKREKFGKRYNCAGDATEALLAREDVEVIITVPNDK
3cdqA           --GYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFN----QDVDAAVRGILRNAKLKP
2aemA           --HVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGAPTRVSDLEKANVRGARAVIVDLESDSE
3e82E           TINIALIGYGFVGKTFHAPLIRSVPGLNVASRDEEKVKRLPDVTVIASPEAAVQHPDVDLVVIASPNATH
2d4aC           ---ITILGAGKVGMATAVMLMMRGYDDLLLIARTPGKPQGEALIRISGSNSYEDMRGSDIVLVTAGIGRK
2aefB           --HVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSD---------------
2eggB           ---SDIIYNQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVI----------------------------
2cdbC           ---VLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKL----------
3btuE           ---VGFVGLNAAKGWAIKTHYPAILITALYSPKIETSIATIQRLKLSNATAFPTLESFAIVIAIQVASHY
3btsA           PIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQTSIATIQRLKLSNATAFPTLESFASSSIVIAIQVASHY
3btsB           ---VGFVGLNAAKGWAIKTHYPAILQTALYSPKIETSIATIQRNATAFPTLESFASSSTIDMIVIAIQVA
2csuB           -KGIAVIGAKKLGYEVFKNLKEYKKGKVYPVNIKEEEVQ----GVKAYKSVKDIPDEIDLAIIVVPKRF-


                         .         .         *         .         .         .         .:140
query           VREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCPVSGGTVGAQAATLTIMVGGK
3ckyC           VETVMNGPGGVLSACKAGTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
2cvzA           VYEVA---EALYPYLREGTYWVDATSGEPEASRRLAERLREKGVTYLDAPVSGGTSGAEAGTLT-VLGGP
3ckyD           VETVM------------NTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
3dojA           ALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGD
3ckyA           VETVMNGPGGVLSACKAGTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
1dljA           SRINYFDTQHVETVIKSHATLIIKSTIPIGFITEMRQKFQTDRII--FSPEFLRESKALYDNLYIIVSCE
1dliA           SRINYFDTQHVETVIKSHATLIIKSTIPIGFITEMRQKFQTDRIIFSPEFLRESKLYDNLYPSRIIVSCE
3cumA           EG-LYLDDDGLLAHIAPGTLVLECSTIAPTSARKIHAAARERGLAL-DAPVSGGTAGAAAGTL-TFVGGD
3ckyB           VETVMNGPGGVLSACKAGTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
2dpoA           LKRKIFAQ---LDSIVDDRVVLSSSSLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSP----
3dzbA           TAYLK---ELADLDLKDNVIITDAGSTKREIVEAAERYLTGKNVQFVGSHPAGSAADVTYYIFTPTSLTK
3c39B           VADKIQLINNMLD--KVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIV----------KDLMSKAE
3dzbB           TAYLK---ELADLDLKDNVIITDAGSTKREIVEAAERYLTGKNVQFVGSHPAGSHAADAYYIFTPTSLTK
3egoA           LVVTVKQSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAF
3egoB           LVVTVKQSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSDA
1bg6A           ATGGALEFRKILRENGAPEVTIGETSSMLFTCRSERPGQVTVNAIKGAMDFACLPAAKAGWALEQIGSVL
3c24A           VAEDIV------PRVRPGTIVLILDAAAPYAGVPERADITYFIGHPCHPPLFNDETDPAARTDYHGGIAG
3dc2B           TAGLIDKE--ALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATEPCTDSPLFELAVVVT
2amfC           FETVL---------KPLHFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMNAQILQSSTALTGNALVS
2amfA           FETV---------LKPLHFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMNAQILQSSTALTGNALVS
1dxyA           NTHIINEA--AFNLMKPGAIVINTARPNLIDTQAMLSNLKSGKLAGVGIDTYEYETEDLLNLAKHGSFKD
2amfE           FETVL---------KPLHFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMNAQILQSSTALTGNALVS
2d5cA           DPSASPLPAELFP---EEGAAVDLVYRPL--WTRFLREAKAKGLKVQTGLPMLAWQG--ALAFRLWTGLL
2ahrC           LGIKPQLFETVLKPLHFKQPIISAAGISLQRLATFVGQDLPLLRIPNNAQILQSST-----ALTGNALVS
2ahrA           -----QLFETVLKPLHFKQPIISAAGISLQRLATFVGQDLPLLRIPNNAQILQSST-----ALTGNALVS
2amfD           FETVLKPLH---------FKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMNAQILQSSTALTGNALVS
3ddnB           TAGLIDKE--ALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATEPCTDSPLFELAVVVT
2cy0B           DPSASPLPAELFP---EEGAAVDLVYRPL--WTRFLREAKAKGLKVQTGLPMLAWQGALA--FRLWTGLL
2cy0A           DPSASPLPAELFP---EEGAAVDLVY--RPLWTRFLREAKAKGLKVQTGLPMLAWQGA--LAFRLWTGLL
2b0jA           QPDII---KKFADAIPEGAIVTHACTIPTTKFAKIFKDLGREDLNITSYHPGCVPEMK-GQVYIAEGYAS
2ahrD           LGIKPQLFETVLKPLHFKQPIISAAGISLQRLATFVGQDLPLLRIPNNAQILQSSTA-----LTGNALVS
3dafA           QPDII---KKFADAIPEGAIVTHACTIPTTKFAKIFKDLGREDLNITSYHPGCV-PEMKGQVYIAEGYAS
2ahrE           ETV--------LKPLHFKQPIISAAGISLQRLATFVGQDLPLLRIPNNAQILQSST-----ALTGNALVS
3c7aA           ISGADVYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLG
3c24B           IEKVA---EDIVPRVRPGTIVLILDAAAPYAGVPERADITYFIGHPCHPPLFNDETDIAKQAIVCALQGP
148lE           VYDSLDAVRRAALINMVFQMGETGVAGFTNSLRLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGT
3dc2A           TAGLIDKE--ALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATEPCTDSPLFELLGAST
2dbqA           TYHLI---NEERLKLKKTAILINIARGKVVDTNALVKALKEGWIAGAGLDVFEEEPYYNEELFKLIGSAS
3d1lB           AFAE------LLQGIVEGKREEALVHTAGSIPNVWEGHVPHYGVF-YPQTFSKQREVDFKEIPFFIEASS
2d5cB           SPLPA-------ELFPEEGAAVDLVYRPL--WTRFLREAKAKGLKVQTGLPMLAWQGALAFRL--WTGLL
3dttA           IILVDIANPLDFSHGPPTLNPVNTDSLGEQIQRTFPEAKVVKTLNTNASLVDPGRAAGGDHSVF-VSGND
2d0iA           TYHII---NEERVKKLEGKYLVNIGRGALVDEKAVTEAIKQGKLKGYATDVFEKEPVREHELFKYEAGLA
3d1lA           LYIVSLKDSAFAELLQGIVEGKREEALVHTAGSIPNVWEGHVPHYGVFYPQTFREVDFKEIPFFIEASST
3c7dB           HEGYF---QAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWAC-RIKEFGRKVEVL
2dbrA           TYHLINEE--RLKLMKKTAILINIARGKVVDTNALVKALKEGWIAGAGLDVFEEEPYYNEELFKLIGSAS
3dttB           IILVDIANPLDFSHGPPTLNPVNTDSLGEQIQRTFPEAKVVKTLNTNASLVDPGRAAGG-DHSVFVSGND
1e5lA           ISLITFHATVIKSAIRQKKHVVTTSYVSPAMMELDQAAKDAGITVMNEIGLDP---GIDHLYAIKTIEEV
3btvB           YEVVMPLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYI
3btvA           HYEVVMLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYI
2eklA           AKPIIDYP--QFELMKDNVIIVNTSRAVAVNGKALLDYIKKGKVYAYATDV-------------------
2d4aB           LLEAMADLAEKIKAYAKDAIVVITTNPVDAMTYVMYKK--------------------------------
3cmmC           VPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGL-----FGNTFVDLGDE
2d4aA           EANANTMADLAIKAYAKDAIVVITTNPVDAMTYVMYKK--------------------------------
3btuB           IDMIPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYI
3db2B           KH---AEVIEQCARSGKHIYVEKPISVSLDHAQRIDQVIKETGVKFLCGHSSRRLGALRKKEIDTKEIGE
3c1oA           MVSVLKQVDIVISALPF-----------------------------------------------------
2aejB           LEKANVRGARAVIVDLESD----------SETIHCILGIRKIDESVRIIAEAERYENIEQL---------
3db2C           HAEV----IEQCARSGKHIYVEKPISVSLDHAQRIDQ---------------------------------
3cdqA           VYD--SLDAVRSCALINMVFQMGETGVAGSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGT
2aemA           TIHCI-----------------------------------------------------------------
3e82E           APLA------RLALNAGKHVVVDKPFTLDQEARELIALAEEKQRLLSVFHNRRWDSDYLGIRQVIEQGTL
2d4aC           NANTMADLAEKIKAYAKDAIVVITTNPVDAMTYVMYKK--------------------------------
2aefB           ----------LEKANVRGARAVIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQL---------
2eggB           ----------------------------------------------------------------------
2cdbC           ----------------------------------------------------------------------
3btuE           EVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYI
3btsA           EVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQG--
3btsB           SHYEVLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQG--
2csuB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AEVLEKVRPLLEQIGKTITHIGDSGAGQVAKLCNQIAQVVNIEGIAEAMRFAGAQGVDTAKVFQAMSTGM
3ckyC           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
2cvzA           EEAVERVRPFLA-YAKKVVHVGPVGAGHAVKAINNALLAVNLWAAGEGLLALVKQGVSAEKALEVINASS
3ckyD           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
3dojA           KALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKSGLSSDTLLDILDLGA
3ckyA           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
1dljA           ENDSPKVKADAEKFNNVPVLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDD
1dliA           ENDSPKVKADAEKFANVPVLIMGASEAEAVKLFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDD
3cumA           AEALEKARPLFEAGRN-IFHAGPDGAGQVAKVCNNQLLAVLIGTAEAALGVANGLEAKV---LAEIRRSS
3ckyB           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
2dpoA           -ATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYA-------IISEAWRLVEEGIVSPSDLDLVMSDGL
3dzbA           ETTIPELKDILSGLKSRYVEIDAAEHDRVTSQISHFPHLLASEQAADYAQAHETNHFAAGGFRDTRIAES
3c39B           KNGVKITLPVDFVTA----DKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAV-TRAKQIVWNGP
3dzbB           ETTIPELKDILSGLKSRYVEIDAAEHDRVTSQISHFPHLLALEQAADYAQAHETNHFAAGGFRDTRIAES
3egoA           DDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTAVKNGELLTTPAYLAFMKLVFQEACRILK
3egoB           EPDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTPFMKLVFQEACRILK
1bg6A           PQYVAVENVLHTSLTNVNRCESGTPFQYYLEGITPSVGSLAEKVDAERIAIAKAFDLNVPSVCEWYPAIY
3c24A           PEEHYAIGADICETWSPVTRTHRVTTEQLAILEPGLSEVAPFVETVHAVDCADRYGIDRQAALDFIGHLN
3dc2B           PHLGASTAEAQDRAGDVAESVRLALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAGVLSDELP---
2amfC           QELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYL--FIEALAKAGVKNGIPKAKALEIVTQTV
2amfA           QELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYL--FIEALAKAGVKNGIPKAKALEIVTQTV
1dxyA           PLWDELLGMPNVVLS---PHIAYYTETAVHNMVYFSLQHLVDFLTKGETSTE------------------
2amfE           QELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYIEALAKAGVKNGIPKAKALEIVTQTVLASA
2d5cA           PDP-SGMEEAARR---------------------------------------------------------
2ahrC           QELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYL--FIEALAKAGVKNGIPKAKALEIVTQTV
2ahrA           QELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYL--FIEALAKAGVKNGIPKAKALEIVTQTV
2amfD           QELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYL--FIEALAKAGVKNGIPKAKALEIVTQTV
3ddnB           PHLGASTAEAQDRAGDVAESVRLALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAGVLSDELPV--
2cy0B           PDPSGMEEAARRALG-------------------------------------------------------
2cy0A           PDPSGMEEAARRALG-------------------------------------------------------
2b0jA           EEAVNKLYEIGKIARGKAFKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEAL
2ahrD           QELQARVRDLTDSFGSTFDISEKDFDTFTA--LAGSSPAYIYLFIEALAKAGVKNGIPKAKALEIVTQTV
3dafA           EEAVNKLYEIGKIARGKAFKMPANLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEAL
2ahrE           QELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYL--FIEALAKAGVKNGIPKAKALEIVTQTV
3c7aA           TKS------------VLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGR
3c24B           EEHYAIGADICETWSPVT-RTHRVTTEQLAILEPGLSEVAPFVETVHAVDECARYGIDRQAALDFIGHLN
148lE           WDAYK-----------------------------------------------------------------
3dc2A           AEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKL---------------------
2dbqA           FGAREGAELVAKNLIA------------------------------------------------------
3d1lB           TEDAAFLKAIASTLSNRVYDADS--EQRKSLHLAAVFTCNFTNHYALAAELLKKYNLP----FDVLPLID
2d5cB           PDPSGMEEAARRALG-------------------------------------------------------
3dttA           AAAKAEVATLLKSLGHQDV-----------IDLGDITTARGAELLPVWIRLWGALGTANFNFKIA-----
2d0iA           LEAQEDVGFRAVENLLKVVPEDLVNKEVLEVRPIE-----------------------------------
3d1lA           EDAAFLKAIA---STLSNRVYDADSEQRKSLHLAAVFTCNFTNHYALAAELLKKYNLPFDVLPLIDETAR
3c7dB           GTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPE
2dbrA           FGAREGMAELVAKNLIAFKR-GEIPPTLVNREVIKIR---------------------------------
3dttB           AAAKAEVATLLKSLGHQDGDITTARGAELLPVWIRLWGALGTANFNFKI---------------------
1e5lA           HAAGGKIKTFLSYCGGLPAPESSDNPLGYKFSWSSRGVLLALRNAASFYKDGKVTNVAGPELMATAKPYF
3btvB           GDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQ
3btvA           GDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQ
2eklA           ----------------------------------------------------------------------
2d4aB           ----------------------------------------------------------------------
3cmmC           FTVLDPTGEEPRT---------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
3btuB           GDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQ
3db2B           VSS-------------------------------------------------------------------
3c1oA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
3db2C           ----------------------------------------------------------------------
3cdqA           WDAYKNL---------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
3e82E           GAV-------------------------------------------------------------------
2d4aC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2cdbC           ----------------------------------------------------------------------
3btuE           GDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPE-
3btsA           ----------------------------------------------------------------------
3btsB           ----------------------------------------------------------------------
2csuB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGSRMLDMLGPKMVTRDFSAGIESRLHAKDFGLAADIATEIGLELPAMRATSAQLGELMDQGWGKDDTSS
3ckyC           GRSYAMEAKMEKFISGDFAGGFAMDLQHKDLGLALEAGKEGNVPLPMTAMATQIFEGGRAMGLGREDMSA
2cvzA           GRSNATENLIPRVLTRAFPKTFALGLLVKDLGIAGV-LDGEKAPSPLLRLAREVYEAKRELGPDADH-VE
3ckyD           GRSYAMEAKMEKFISGDFAGGFAMDLQHKDLGLALEAGKEGNVPLPMTAMATQIFEGGRAMGLGREDMSA
3dojA           MTNPMFKGKGPSMNKSSYPPAFPLKHQQKDMRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSA
3ckyA           GRSYAMEAKMEKFMSGDFAGGFAMDLQHKDLGLALEAGKEGNVPLPMTAMATQIFEGGRAMGLGREDMSA
1dljA           RIGMHYNNPSF---------GYGGYSLPKDTKQLLANYNNIPQTLIEAIV--------------------
1dliA           RIGMHYNNPSF---------GYGGYCLPKDTKQLLANYNNIPQTLIEAIV--------------------
3cumA           GGNWALEVYNPWPGPASRDYSGGFAQLAKDLGLAQEAAQASASSTPGSLALS-LYRLLLKQGYAERDFSV
3ckyB           GRSYAMEAKMEKFIMSGDFAGGFADLQHKDLGLALEAGKEGNVPLPMTAMATQIFEGGRAMGLGREDMSA
2dpoA           GMRYAFIGPLETMHLNAEGMLSYSDRYSEGMKRVLKSFGSIPEFSGATVE--KVNQAMCKKVPADPEHLA
3dzbA           ------EPGWASILTNGPAVLDRIEDFKKRLDHVADLIKAEDESWEFFDNGRKKRKEEIHKKGGVES---
3c39B           VGVFEWEAFARGTKALMDEVVKATSRGCITIDKVSHVSTGGGASLELLEGKVLPGVDALSN---------
3dzbB           EPG------WASILTNGPAVLDRIEDFKKRLDHVADLI--------------------------------
3egoA           LENEEKAWERVQAVCGQTKENRSSMLVDAIIGYLLKEASLQGLDAVHLEF--------------------
3egoB           LENEEKAWERVQAVCGQTKENRSSMLVDAIIGYLLKEASLQGLDAVHLEF--------------------
1bg6A           EAVQGNPAYRGIAGPINLNTRYFFEDVSTGLVPLSELGRAVNVPTPLIDAVLDLISSLIDTDFRKEGRTL
3c24A           VEIAWLEFAKDIVVKEDWREALNPAKVKQAAELIA-----------------------------------
3dc2B           ----------------------------------------------------------------------
2amfC           LASASNLKTSHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKT-----------------------
2amfA           LASASNLKTSHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTI----------------------
1dxyA           ----------------------------------------------------------------------
2amfE           SNLKTSSQSPHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKT-----------------------
2d5cA           ----------------------------------------------------------------------
2ahrC           LASASNHDFIDAICSPGGTTIAGLELERLGLTATVSSAIDKTIDK-------------------------
2ahrA           LASASNHDFIDAICSPGGTTIAGLELERLGLTATVSSAIDKTIDK-------------------------
2amfD           LASASNLKTSHDFIDAICSPGGTTIAGLMELERLGLTATVSSAIDKTI-DKAKSL---------------
3ddnB           ----------------------------------------------------------------------
2cy0B           ----------------------------------------------------------------------
2cy0A           ----------------------------------------------------------------------
2b0jA           TQINLMKEKGIANMEEALDPAALLG---------------------------------------------
2ahrD           LASSNLKTSSQAICSPGGTTIAGLELERLGLTATVSSAIDKTID--------------------------
3dafA           TQINLMKEKGIANMEEALD---------------------------------------------------
2ahrE           LASASNHDFIDAICSPGGTTIAGLELERLGLTATVSSAIDKTID--------------------------
3c7aA           WGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPG-----------------------
3c24B           VEIAWFEFAKDIVVKEDWREALNPAKVKQAAELIA-----------------------------------
148lE           ----------------------------------------------------------------------
3dc2A           ----------------------------------------------------------------------
2dbqA           ----------------------------------------------------------------------
3d1lB           ETARKVHELEPKTAQTGPAIRYDENVIGNHLRLADDPAQRLYELLS------------------------
2d5cB           ----------------------------------------------------------------------
3dttA           ----------------------------------------------------------------------
2d0iA           ----------------------------------------------------------------------
3d1lA           KVHELEPKTAQTGPAIRYDEN----VIGNHLRLADDPAQRLYELLS------------------------
3c7dB           APLFYQGIDQADMLTACSNECKDVANAIMAACPGNDLSDVKD----------------------------
2dbrA           ----------------------------------------------------------------------
3dttB           ----------------------------------------------------------------------
1e5lA           IYP-------------------------------------------------------------------
3btvB           ELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSF-------------------------------
3btvA           ELIDE-----------------------------------------------------------------
2eklA           ----------------------------------------------------------------------
2d4aB           ----------------------------------------------------------------------
3cmmC           ----------------------------------------------------------------------
2d4aA           ----------------------------------------------------------------------
3btuB           ELIDE-----------------------------------------------------------------
3db2B           ----------------------------------------------------------------------
3c1oA           ----------------------------------------------------------------------
2aejB           ----------------------------------------------------------------------
3db2C           ----------------------------------------------------------------------
3cdqA           ----------------------------------------------------------------------
2aemA           ----------------------------------------------------------------------
3e82E           ----------------------------------------------------------------------
2d4aC           ----------------------------------------------------------------------
2aefB           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
2cdbC           ----------------------------------------------------------------------
3btuE           ----------------------------------------------------------------------
3btsA           ----------------------------------------------------------------------
3btsB           ----------------------------------------------------------------------
2csuB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LLKVLELKG
3ckyC           VIKVWE---
2cvzA           ALRLLERWG
3ckyD           VIKVWE---
3dojA           VIEAVK---
3ckyA           VIKVWE---
1dljA           ---------
1dliA           ---------
3cumA           VQKLFD---
3ckyB           VIKVWE---
2dpoA           ARREWR---
3dzbA           ---------
3c39B           ---------
3dzbB           ---------
3egoA           ---------
3egoB           ---------
1bg6A           EKLGLS---
3c24A           ---------
3dc2B           ---------
2amfC           ---------
2amfA           ---------
1dxyA           ---------
2amfE           ---------
2d5cA           ---------
2ahrC           ---------
2ahrA           ---------
2amfD           ---------
3ddnB           ---------
2cy0B           ---------
2cy0A           ---------
2b0jA           ---------
2ahrD           ---------
3dafA           ---------
2ahrE           ---------
3c7aA           ---------
3c24B           ---------
148lE           ---------
3dc2A           ---------
2dbqA           ---------
3d1lB           ---------
2d5cB           ---------
3dttA           ---------
2d0iA           ---------
3d1lA           ---------
3c7dB           ---------
2dbrA           ---------
3dttB           ---------
1e5lA           ---------
3btvB           ---------
3btvA           ---------
2eklA           ---------
2d4aB           ---------
3cmmC           ---------
2d4aA           ---------
3btuB           ---------
3db2B           ---------
3c1oA           ---------
2aejB           ---------
3db2C           ---------
3cdqA           ---------
2aemA           ---------
3e82E           ---------
2d4aC           ---------
2aefB           ---------
2eggB           ---------
2cdbC           ---------
3btuE           ---------
3btsA           ---------
3btsB           ---------
2csuB           ---------