[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF09846.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2bteA.bssp"
#ERROR : Can't open dsspfile "1abbA.bssp"
#ERROR : Can't open dsspfile "1c8kA.bssp"
#ERROR : Can't open dsspfile "2amvA.bssp"
#ERROR : Can't open dsspfile "1axrA.bssp"
#ERROR : Can't open dsspfile "3e3nF.bssp"
#ERROR : Can't open dsspfile "3bjqF.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "3bjqI.bssp"
#ERROR : Can't open dsspfile "2c1wC.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "2ajgA.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "2c1wB.bssp"
#ERROR : Can't open dsspfile "1bs2A.bssp"
#ERROR : Can't open dsspfile "3dpgA.bssp"
#ERROR : Can't open dsspfile "2ajhB.bssp"
#ERROR : Can't open dsspfile "2ajgB.bssp"
#ERROR : Can't open dsspfile "2bvtA.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "3c8zA.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "1b80A.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "2c1fA.bssp"
#ERROR : Can't open dsspfile "3bicB.bssp"
#ERROR : Can't open dsspfile "3bicA.bssp"
#ERROR : Can't open dsspfile "3cglD.bssp"
#ERROR : Can't open dsspfile "2dlcX.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "3egbB.bssp"
#ERROR : Can't open dsspfile "3e3nB.bssp"
#ERROR : Can't open dsspfile "3cglC.bssp"
#ERROR : Can't open dsspfile "2aelB.bssp"
#ERROR : Can't open dsspfile "1cjyB.bssp"
#ERROR : Can't open dsspfile "2aelA.bssp"
#ERROR : Can't open dsspfile "3dl5B.bssp"
#ERROR : Can't open dsspfile "1bt1A.bssp"
#ERROR : Can't open dsspfile "3d6uA.bssp"
#ERROR : Can't open dsspfile "2bcvA.bssp"
#ERROR : Can't open dsspfile "2aekA.bssp"
#ERROR : Can't open dsspfile "1ei5A.bssp"
#ERROR : Can't open dsspfile "3e3nD.bssp"
#ERROR : Can't open dsspfile "3e3nH.bssp"
#ERROR : Can't open dsspfile "3d6vA.bssp"
#ERROR : Can't open dsspfile "2azxA.bssp"
#ERROR : Can't open dsspfile "3e3nA.bssp"
#ERROR : Can't open dsspfile "1a1xA.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "2bcrA.bssp"
#ERROR : Can't open dsspfile "3c5fA.bssp"
#ERROR : Can't open dsspfile "2bcqA.bssp"
#ERROR : Can't open dsspfile "2a6tA.bssp"
#ERROR : Can't open dsspfile "2e50B.bssp"
#ERROR : Can't open dsspfile "3c98A.bssp"
#ERROR : Can't open dsspfile "2c1sA.bssp"
#ERROR : Can't open dsspfile "3cfiJ.bssp"
#ERROR : Can't open dsspfile "2ab5B.bssp"
#ERROR : Can't open dsspfile "2arlA.bssp"
#ERROR : Can't open dsspfile "3ecjA.bssp"
#ERROR : Can't open dsspfile "3bjqH.bssp"
#ERROR : Can't open dsspfile "2cycA.bssp"
#ERROR : Can't open dsspfile "3bjqE.bssp"
#ERROR : Can't open dsspfile "3ci0I.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"
#ERROR : Can't open dsspfile "2an2A.bssp"
#ERROR : Can't open dsspfile "1b25A.bssp"
#ERROR : Can't open dsspfile "2cybA.bssp"
#ERROR : Can't open dsspfile "2c1qA.bssp"
#ERROR : Can't open dsspfile "3e4cB.bssp"
#ERROR : Can't open dsspfile "3e4cA.bssp"
#ERROR : Can't open dsspfile "3d5hA.bssp"
#ERROR : Can't open dsspfile "1bdgA.bssp"
#ERROR : Can't open dsspfile "2crqA.bssp"
#ERROR : Can't open dsspfile "2d5bA.bssp"
#ERROR : Can't open dsspfile "2d54A.bssp"
#ERROR : Can't open dsspfile "1a8hA.bssp"
#ERROR : Can't open dsspfile "3c8zB.bssp"
#ERROR : Can't open dsspfile "2ag6A.bssp"
#ERROR : Can't open dsspfile "2csxA.bssp"
#ERROR : Can't open dsspfile "2ct8A.bssp"
#ERROR : Can't open dsspfile "3d6vA.bssp"
#ERROR : Can't open dsspfile "2cybB.bssp"
#ERROR : Can't open dsspfile "2cfoB.bssp"
#ERROR : Can't open dsspfile "2cfoA.bssp"

## Summary of PDB Search
:873
    e-146  45%  2bteA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    3e-73   9%  1abbA  [c.87.1] GLYCOGEN PHOSPHORYLASE B
    5e-65   9%  1c8kA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    9e-65   8%  2amvA  [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
    5e-59   9%  1axrA  [x.x.x] GLYCOGEN PHOSPHORYLASE
    3e-57   8%  3e3nF  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-49  10%  3bjqF  [x.x.x] PHAGE-RELATED PROTEIN
    3e-47  17%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    2e-44  12%  3bjqI  [x.x.x] PHAGE-RELATED PROTEIN
    4e-44  11%  2c1wC  [x.x.x] ENDOU PROTEIN
    5e-44  18%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    9e-44  55%  2ajgA  [x.x.x] LEUCYL-TRNA SYNTHETASE
    8e-42  18%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    1e-40  11%  2c1wB  [x.x.x] ENDOU PROTEIN
    3e-40  11%  1bs2A  [d.67.2 - c.26.1 - a.27.1] PROTEIN (ARGINYL-TRNA SYNTHETASE)
    2e-39  12%  3dpgA  [x.x.x] SGRAIR RESTRICTION ENZYME
    1e-38  55%  2ajhB  [x.x.x] LEUCYL-TRNA SYNTHETASE
    3e-38  54%  2ajgB  [x.x.x] LEUCYL-TRNA SYNTHETASE
    4e-38   9%  2bvtA  [x.x.x] BETA-1,4-MANNANASE
    1e-36  13%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    2e-35  12%  3c8zA  [x.x.x] CYSTEINYL-TRNA SYNTHETASE
    3e-35  14%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE
    7e-35  10%  1b80A  [a.93.1] PROTEIN (RECOMBINANT LIGNIN PEROXIDASE H8)
    1e-33  17%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE
    2e-33  11%  2c1fA  [x.x.x] BIFUNCTIONAL ENDO-1,4-BETA-XYLANASE A
    1e-32   6%  3bicB  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    1e-32   6%  3bicA  [x.x.x] METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
    2e-31   5%  3cglD  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    2e-31   9%  2dlcX  [x.x.x] TYROSYL-TRNA SYNTHETASE, CYTOPLASMIC
    3e-31  13%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE
    6e-31  12%  1d2rA  [c.26.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    4e-29  12%  3egbB  [x.x.x] PROTEIN PELLINO HOMOLOG 2
    6e-27  20%  3e3nB  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    7e-27   6%  3cglC  [x.x.x] GFP-LIKE FLUORESCENT CHROMOPROTEIN DSFP483
    9e-27   9%  2aelB  [x.x.x] TRICHODIENE SYNTHASE
    2e-26   9%  1cjyB  [b.7.1 - c.19.1] PROTEIN (CYTOSOLIC PHOSPHOLIPASE A2)
    8e-26   8%  2aelA  [x.x.x] TRICHODIENE SYNTHASE
    2e-25   7%  3dl5B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-25  15%  1bt1A  [a.86.1] PROTEIN (CATECHOL OXIDASE)
    2e-25  15%  3d6uA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    5e-24  12%  2bcvA  [x.x.x] DNA POLYMERASE LAMBDA
    6e-24  10%  2aekA  [x.x.x] TRICHODIENE SYNTHASE
    3e-23   5%  1ei5A  [e.3.1 - b.61.3 - b.61.3] D-AMINOPEPTIDASE
    5e-23  19%  3e3nD  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    5e-23  19%  3e3nH  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    7e-23  17%  3d6vA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    4e-22   9%  2azxA  [x.x.x] TRYPTOPHANYL-TRNA SYNTHETASE
    9e-22  19%  3e3nA  [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
    2e-21   9%  1a1xA  [x.x.x] HMTCP-1
    6e-21  16%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE
    3e-20  12%  2bcrA  [x.x.x] DNA POLYMERASE LAMBDA
    4e-20  14%  3c5fA  [x.x.x] DNA POLYMERASE LAMBDA
    5e-20  11%  2bcqA  [x.x.x] DNA POLYMERASE LAMBDA
    8e-20  15%  2a6tA  [x.x.x] SPAC19A8.12
    8e-20   9%  2e50B  [x.x.x] PROTEIN SET
    3e-19  11%  3c98A  [e.25.1 (1dn1A)] SYNTAXIN-BINDING PROTEIN 1
    2e-16   6%  2c1sA  [x.x.x] BIOTIN BINDING PROTEIN A
    1e-15   6%  3cfiJ  [x.x.x] TYPE II SECRETORY PATHWAY, PSEUDOPILIN EPSI
    2e-15   8%  2ab5B  [x.x.x] MRNA MATURASE
    3e-15  12%  2arlA  [x.x.x] GFP-LIKE NON-FLUORESCENT CHROMOPROTEIN
    3e-15   9%  3ecjA  [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)
    6e-15  13%  3bjqH  [x.x.x] PHAGE-RELATED PROTEIN
    6e-15  10%  2cycA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    3e-14  10%  3bjqE  [x.x.x] PHAGE-RELATED PROTEIN
    4e-14  11%  3ci0I  [x.x.x] PSEUDOPILIN GSPI
    2e-13  23%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    2e-13  17%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE
    3e-13  10%  2an2A  [x.x.x] P332G A333S DOUBLE MUTANT OF NITRIC OXIDE
    3e-12  21%  1b25A  [d.152.1 - a.110.1] PROTEIN (FORMALDEHYDE FERREDOXIN
    3e-11  24%  2cybA  [x.x.x] TYROSYL-TRNA SYNTHETASE
    6e-11   6%  2c1qA  [x.x.x] BIOTIN BINDING PROTEIN A
    3e-09   9%  3e4cB  [x.x.x] CASPASE-1
    6e-06  12%  3e4cA  [x.x.x] CASPASE-1
    5e-05  17%  3d5hA  [x.x.x] HAEMENTHIN
    3e-04   7%  1bdgA  [x.x.x] HEXOKINASE
    3e-04   5%  2crqA  [x.x.x] MITOCHONDRIAL TRANSLATIONAL INITIATION FACTOR 3
    1e-19  19%  2d5bA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 491->816)
    3e-18  18%  2d54A  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 487->816)
    1e-20  17%  1a8hA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 491->816)
    2e-07  11%  3c8zB  [x.x.x] CYSTEINYL-TRNA SYNTHETASE(query 492->750)
    6e-06  16%  2ag6A  [x.x.x] TYROSYL-TRNA SYNTHETASE(query 636->693)
    4e-25  11%  2csxA  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 343->817)
    1e-29  16%  2ct8A  [x.x.x] METHIONYL-TRNA SYNTHETASE(query 37->229)
    9e-05  11%  3d6vA  [x.x.x] TYROSYL-TRNA SYNTHETASE(query 506->683)
    1e-04  16%  2cybB  [x.x.x] TYROSYL-TRNA SYNTHETASE(query 486->671)
    7e-08  11%  2cfoB  [x.x.x] GLUTAMYL-TRNA SYNTHETASE(query 492->801)
    3e-07   8%  2cfoA  [x.x.x] GLUTAMYL-TRNA SYNTHETASE(query 489->825)
:873

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
2bteA           --EKYNPHAIEAKWQRFWEEKGFMKAKDL---PGGRGKQYVLVMF--PYPSGDLHMGHLKNYTMGDVLAR
1abbA           TMRLWSAKAPNDFNLKDFNVGGYIQAVL--------DRNLAENISRVLYPEGKLRLKQEYFATLQDIIRR
1c8kA           TMRLWSAKAPNDFNLKDFNVGGYIQAVL--------DRNLAENISRVLYPNDNFFEGKELRATLQDIIRR
2amvA           TMRLWSAKAPNDFNLKDFNVGGYIQAVL--------DRNLAENISRVLYPNDNFFEGKEVAATLQDIIRR
1axrA           PGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQALDRNLAENISRVLYPNDNFFEGKEVAATLQDIIRR
3e3nF           QVVLAMPYDTPVPGYRNNVVNTMRLWSAK---APNGYIQAVLDRNLAENISRVLYGKELRLATLQDIIRR
3bjqF           -----------------------------------------------------HARGYRQSTLIGKKLFP
2d5bA           -------------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAR
3bjqI           ----------------------------------------------------------------------
2c1wC           ----QLNHELSKLFNELWDADQNRMK---------SGKDYRISLQGKAGYVSFPLFQFVDEEKLKKTFAT
2d54A           -------------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAR
2ajgA           ----------------------------------------------------------------------
1a8hA           -------------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAR
2c1wB           -----LNHELSKLFNELWDADQNRMKSGKDY-----RISLQGKAGYVPSASFPLFQFVDEEKLKSRKTFA
1bs2A           IQFFFNPQFLAKLVIPDILTRKEDYGSC-----KLVENKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLAN
3dpgA           ---------------------------------ERCIQDIRNAPVRNRSTQFQLAQQNMLAYTFGEVIPG
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3c8zB           ---QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTPGP-TATMYVCGITPYDATHLGHAATYLTFDLVHR
3c8zA           ---QSWSAPAIPVVPGRGPALRLFDSADRQVRPVTPGP-TATMYVCGITPYDATHLGHAATYLTFDLVHR
2ag6A           ------EFEMIKRNTSEI--ISEEELREVLK--KDEKSALIG-----FEPSGKIHLGH------------
1b80A           ----------------------------------------------------------------------
2csxA           ---------------------------------TLMKK--FYVTTPIYYVNDVPHLGHAYTTIAADTIAR
2c1fA           -----------------------------------------GNGQNQHKGVNDGFSYEIWLD--------
3bicB           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2dlcX           ---NEAFGLITKNLQEVLNPQIIKDVL--------EVQKRHLKLYWGTAPTGRPHCGY----FVPMTKLA
2ct8A           ----------------------------------------------------------------------
1d2rA           -----------------------------------------------IQPSGVITIGNYIGALRQFVELQ
3egbB           ------PSTVHVISTCKGQHSISYTLSRNQTVVV----------EYTHDKDTDMQVGRSTESPIDFVVTD
3e3nB           --------------------------------------------SRVLYPGKELRLKQVVAATLQDIIRR
3cglC           ----------------------------------------------------------------------
2aelB           FNERSLFLEITSAIAQMENWMVWVNDLMSFYKEFDDERDQISLVKNYVVSDE-ISLHEALEKLTQDTLHS
1cjyB           ----------------------------------------------------------------------
2aelA           FLEITSAIAQMENWMVWVNDLMSFYKEFDDERD-------QISLVKNYVVSDEISLHEALEKLTQDTLHS
3dl5B           -------------------------------------MRESFPLLTTKKVFIRSIFEELIWFIKGDTNGN
1bt1A           ----------------------------------------------------------------------
3d6uA           ------------------------------------KKDEKSAIIGF-EPSGKIHLGH------------
2bcvA           DVDVLITHPDGRSHRGIFSRLLDSLR------QEGFLTDDLVSQEENGQQQKYLGVCRLRRHRRLDIIVV
2aekA           FLEITSAIAQMENWMVWVNDLMSFYKEFD-------DERDQISLVKNYVVSDEISLHEALEKLTQDTLHS
1ei5A           ----------------------------------------------------------------------
3e3nD           --------------------------------------------------------------TLQDIIRR
3e3nH           --------------------------------------------------------------TLQDIIRR
3d6vA           ------------------------------------KKDEKSAIIGF-EPSGKIHLGH------------
2azxA           KELINRIERATGQRPHHFLRRGIFFSHRDNQVLDAYENKKPFYLYTGRGPSSEAHVGHLIPFIFTKWLQD
3e3nA           --------------------------------------------------------------TLQDIIRR
1a1xA           ----------------------------------------------------------------------
2cybB           MDITEKLRLITRNAEEVVTEEELRQLIE--------TKEKPRAYVGYE-PSGEIHLGH------------
2bcrA           DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQ--EENGQQQKYLGVCRLPGPGRRHRRLDIIVV
3c5fA           -----------------------------------EGFLTDDLVSQEENGQQQKYLGVCRRHRRLDIIVV
2bcqA           DVDVLITHPDGRSHRGIFSRLLDSLRQEGF--LTDDLVSQEENGQQQKYLGVCRLPGPGRRHRRLDIIVV
2a6tA           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2c1sA           ---------LQGLWRNELGSNMTISA------LDVAGTFSGSYQTAVTATNKQILVSPLKGAQQPPGTKG
3cfiJ           --------------------------------------------------------------------NT
2ab5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cycA           MDIEERINLVLKKPTEEVLTVENLRH--------LFEIGAPLQHYIGFEISGYIHLGT---GLMAGAKIA
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ---------------------------------------------LAPSPTGNLHIGTARTAVFNWLYAR
2cfoA           ---------------------------------------------LAPSPTGNLHIGTARTAVFNWLYAR
2an2A           ----------------------------------------------------------------------
1b25A           TGVTYTWDDLYKAADRVYSLIRAYWVREFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLDEKKYDELLSE
2cybA           -----------------------------------ETKEKPRAYVGYE-PSGEIHLGH------------
2c1qA           ---------------------------------------------YQTAVTATKQILVSPLKGAQQPPKG
3e4cB           --------------------------------DKSSRTRLALIICNEEFD----SIPRRTGAEVITGMTM
3e4cA           ------------------------------------------------------SIPRRTGAEVITGMTM
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ct8A           ------------------------------------LMKKFYVTTPIYYVNDVPHLGHAYTTIAADTIAR
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYR
2bteA           FRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPEYYR
1abbA           FKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLAWEVTVKTCAYTNHTVIPEALER
1c8kA           FKSSKF-GCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDKAWEVTVKTCAYTNHTVIPEALER
2amvA           F-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMLDWDKAWEVTVKTCAY-TNHTVLPEALER
1axrA           F-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLVTVKTCAYTNHTVLPEALER
3e3nF           F-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDTVKTCAYTNHTVLPEALER
3bjqF           VAPVYGGKIL-TFGKEAFRLYNTKRAPGANT--------------KRIDFGYEGDPYSIVPSALEAKV--
2d5bA           WHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKK
3bjqI           --THARGYRQSTLIGKKLFPVAPVA----------QYGGKILTFGKEAFRLYNTKRT--KRIDFGYEGDP
2c1wC           FISLLD-NYEMDTGVAEVVTPEEIAENNNFLDAILETK--------VMKMAHDYLVRKNQAKPTRNDFKV
2d54A           WHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKK
2ajgA           ----------------------------------------------------------------------
1a8hA           WHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKK
2c1wB           TFISLLDNYEMDTGVAEVVTPEEIAENNNFLDAILETK--------VMKMAHDYLVRKNQAKPTRNDFKV
1bs2A           LYEKLGWEVIRMNYLGDWGKQFGLLAFERYGNEEALVKDPIHHLFDVYVRINKDIEEEGDSIPLEQSTNG
3dpgA           FASA-GINGMDYR--DVIGRPVEN-AVTEGTHFFRDDFRVDSNAKAKVAGDIFEIVSSAVMWNCAARWN-
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3c8zB           LWLDAGHTVQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAAT---DAIA
3c8zA           LWLDAGHTVQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRVLPPHDYVAAT---DAIA
2ag6A           YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFQLDKDYT
1b80A           ----------------------------------------------------------------------
2csxA           YYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLK--IEYTKFIRTTDPYHVK
2c1fA           --NTGGNGSMTGSGATFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYGLDYAATYKQTASASGNCVYG
3bicB           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2dlcX           DFLKAGCEVTVLLADLHAFLDNMKA---PLEVVNYRAKYYELTIKAILRSINVPIEKLKFVVGSSYQLTP
2ct8A           ----------------------------------------------------------------------
1d2rA           ------------HEYNCYFCIVDQHAITVWQDP-HELRQNIRRLAALYLAVGIDPTQ----------ATL
3egbB           TQITQST-ISRFACRIVCDRNEPYTAR--IFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHP
3e3nB           F-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAYTLER
3cglC           ----------------------------------------------------------------------
2aelB           SKQMSDKDPQVMDTIECFMHGYVTWHLCDRKYRLSEIYEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQL
1cjyB           ----------------------------------------------------------------------
2aelA           SKQMSDKDPQVMDTIECFMHGYVTWHLCDRKYRLSEIYEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQL
3dl5B           HLIEKKVYIWSGNGSKEYLERIGLGHREENDLG--------PIYGFQWRHYN--GEYKTMHDDYTGVGVD
1bt1A           ----------------------------------------------------------------------
3d6uA           YLQIKKMIDLQNAGFDIIILLADLFAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFMLDKDYT
2bcvA           PYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHGCK--VGPGRVLPTPTE----
2aekA           SKQMVAKDPQVMDTIECFMHGYVTWHLCDR------------------------KYRLSEIYEKVKEEKT
1ei5A           ----------------------------------------------------------------------
3e3nD           FKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAEALER
3e3nH           F-KSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAEALER
3d6vA           YLQIKKMIDLQNAGFDIIILLADLFAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSSFMLDKDYT
2azxA           ------------VFNVPLVIQTDDEKYLWKDLTLDQAYGDAVENAKDII--ACGFDINKTFIFSDLDYGS
3e3nA           FKSS-KFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAI---PELMRVLVDLERLDWDWEVTVKTCAEALER
1a1xA           ---------------EDVGAPPDHLWVEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLT----
2cybB           MMTVQKLMDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIALGLDESRAKFVLGSEYQLSR
2bcrA           PYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHGCKVGPGRVLP--TPTE----
3c5fA           PYSEFACALLYFTGSAHFNRSMAALAKTKGMSL--SEHALSTAVVRNTHGCK--VGPGRVLPTPTE----
2bcqA           PYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHA--LSTAVVRNTHGCKVGPGRVLP--------TP
2a6tA           FTNATFSQVLDDLSARFLNLPAEEQSSVFQIEQAHWFYDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKW
2e50B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2c1sA           QQPTFGFTVQWQFTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTNFTR-----------
3cfiJ           VGYLEQKMFA---AMVADNQMAMVMLNPKNLKTWYWKVAPVATTQPLLKAFDVSVAAEKQASPIITVR--
2ab5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cycA           DFQKAGIKTRVFLADW-HSWINDKLGGDLEVIQEVALKYFKVGMEKSIEVMGGDPKKVEFVLASEILEKG
3bjqE           ----------------------------------------------------------------------
3ci0I           --VLEEKTVYLTRGQRAVRQQGESDA-----GSRWYWRTTPLSTGNALQAVDIEVSLHEDFSSVIQSRRA
2cfoB           H--RGGKFILRIEDTD----------------RERSRPEYTENILEGLQWLGLTWDE---GPYFQSDRLD
2cfoA           H--RGGKFILRIEDTD----------------RERSRPEYTENILEGLQWLGLTWDEGP---YFQSDRLD
2an2A           ----------------------------------------------------------------------
1b25A           YYRI--------RGWDERGIPKKETLKELDLD------FVIPELEKVTN---------------------
2cybA           MMTVQKLMDLQEAGFEIIVLLADIHAYLNEKGTFEEIAEVADYNKKVFIALGLDESRAKFVLGSEYQLSR
2c1qA           QQPTFGFTVQWQFTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTNV-------------
3e4cB           LLQNLGYSVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQL-----
3e4cA           LLQNLGYSVDVKK--NLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIRECGKKHSEQVPDILQ----
3d5hA           ----------ARTKKVFLGFPAHPDAAGSGYMPPEVKFHVFPAAKKSYKFGGIML-WDWDTVSNFSSKIL
1bdgA           -----------------------------------LDCWRTQFDKSMDIDSLHPGKQLYEKMVSGMYLGE
2crqA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ct8A           YYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLK--IEYTKFIRTTDPYHVK
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           WNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLG
2bteA           WNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVERCWRHEDTPVEKRELEQWYLRITAYAERLLK
1abbA           WPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVA
1c8kA           WPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVA
2amvA           WPVHLLETLLPRHLQIIYEINQRFFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
1axrA           WPVHLLETLLPRHLQIIYEINAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEIL
3e3nF           WPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVA
3bjqF           ------------PRELRDASQVPGIDLGARS-------------------VNTVLRIALAHEHECAQIAL
2d5bA           VVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQE
3bjqI           YSIVPSALEAKVPRELRDASQVPGIDLGARSVNTVLRIALAHEHEC--------AQIALDPAKY------
2c1wC           QLYNIWFQLYSRAPGSRPDSCGFEHVFVGESKRGQE------------MMGLHNWVQFYLQEKRKNIDYK
2d54A           VVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRQEYIQ
2ajgA           ----------------------------------------------------------------------
1a8hA           VVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEPWLQEYIQ
2c1wB           QLYNIWFQLYSRAPGSRPDSCGFEHVFVGESKRGQEMMGLHNW------------VQFYLQEKRKNIDYQ
1bs2A           KAREYFKRMEDGDEEALKIWKRFREFSIEKYIDTYARIKYDVYSGESQVSKESMLKAIDLFKEKGLTHED
3dpgA           --SLMVGEGWRSQPRYSRPTLSPSPRRQVA---VLNLPRSFDWVSLLVPESQEVIEEFRAGLRKDGLGLP
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3c8zB           EVVEMVEKLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYDRDTMLTLFAERGGDPDRPGKSDQLDAL
3c8zA           EVVEMVEKLLASGAAYIVEDAEYPDVYFRADATAQFGYESGYDRDTMLTLFAERGGDP------------
2ag6A           LNVYRLALKTTLKRARRSMELIAREDENPKVAEVIQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKKVV
1b80A           ----------------------------------------------------------------------
2csxA           FVQKVFEECYKRGDIYLGEYKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSVT
2c1fA           WFQNRGLNGVPLVEYYIIEDWVDWVPDAQMVTIDGAQYIFQMDHTGPTINGGSEQYFSVRQQKRTSGHIT
3bicB           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2dlcX           DYTMDIFRLSNIVSQNDAKRAGADVVKQVA--------------------NPLLSGLIYPLMQALDEQFL
2ct8A           ----------------------------------------------------------------------
1d2rA           FIQSEVPAHAQAAWMLQCIVYIGELERMTQFYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNK
3egbB           RQPGVWREISVCGDVYTL--RETRSAQQRGKLVESETDGSLIDLCGATLLWRTADGLFHTPTQKHIEAL-
3e3nB           WPVHLLETLLPRHLQRFLNRVAAAFPGDVDRLRRMSLVEEGA----------------------------
3cglC           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3dl5B           QLAKLIETLKNNPKDRRHI-LTAWNPSA--LSQMALPPCHVLSQYYVTNDNCLSCNLYQRSCDLGLGS--
1bt1A           ----------------------------------------------------------------------
3d6uA           LNVYRLALKTTLKRARRSMELIAREDENPKVEVIYPIMQVNPLHYGVDVAVGGMEQKIHMLAELLPKKVV
2bcvA           --KDVFRLL---GLPYREPAERDW----------------------------------------------
2aekA           EDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN------------------------------------
1ei5A           ----------------------------------------------------------------------
3e3nD           WPVHLLETLLPRHLQRFLNRVAAAFPGDVDRLRRMSLVEEGA----------------------------
3e3nH           WPVHLLETLLPRHLQRFLNRVAAAFPGDVDRLRRMSLVEEGA----------------------------
3d6vA           LNVYRLALKTTLKRARRSMELIAREDENPKVAEVIQVNPLHYEGVDVAVGGMEQRKIHMLARELLPKVLT
2azxA           SGFYKNV------VKIQKHVTFNQVKGIFGFTDSDCI----GKISFPAIQAAPS--FSNSFPQIFRDRTD
3e3nA           WPVHLLETLLPRHLQRFLNRVAAAFPGDVDRLRRMSLVEEGA----------------------------
1a1xA           -SQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGQELL--------------------------------
2cybB           DYVLDVLKMARITTLNRARRSMEDPMVSQMIYPLMQALDIAHLGVDLAVGGIDQRKIHMLARENLPRLGY
2bcrA           --KDVFRLL---GLPYREPAERDW----------------------------------------------
3c5fA           --KDVFRLL---GLPYREPAERDW----------------------------------------------
2bcqA           TEKDVFRLL---GLPYREPAERDW----------------------------------------------
2a6tA           HEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDEAIREVYEETGFDCSSRI
2e50B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
3bjqH           -----------------------EAKVPRELRDASQVPG-IDLGARSVNTVLRIALAHEHECAQIALDPA
2cycA           DYWQTVIDISKNVTLSRVMRSITI----------------------------------------------
3bjqE           ----------EAFRLYNTKRAPGANTKRGYEGDPYSIVPSVPRELRDASQVPGIDLGARSVNTVLRIALA
3ci0I           W---------------------------------------------------------------------
2cfoB           LYRQAIQTLLDKGLAYYCYCTPEE----------------------------------------------
2cfoA           LYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIE
2an2A           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2cybA           DYVLDVLKM-------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           --NAIFNMLNTKNCPSLKDKPK------------------------------------------------
3e4cA           -LNAIFNMLNTKNCPSLKDK--------------------------------------------------
3d5hA           GEGW------------------------------------------------------------------
1bdgA           LVRHIIVYLVEQKILFRGDLPERLKVRNSLLTRYLTDV--------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ct8A           FVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIISFVKQGLKDLSV
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPL
2bteA           DLEGLNWPEKVKAMQRAWIGRSEGAEILFPVE--------GKEVRIPVFTTRPDTLFGATFLVLAPEHPL
1abbA           RIHSELKKTIFKDFYELEPHKFQNKTNGITPRR-------WLVLCNPGLAEIIAERIGEEYISDLDQLRK
1c8kA           RIHSILKKTIFKDFYELEPHKFQNKTNGITPR--------RWLVLCNPGLAEIIAERIGEEYISDLDQLR
2amvA           KKTIFKDFYELEPHKFQNKTNGITPRRWLV---------LCNPGLAEIIAERIGEEYISDLDQLRKLLSY
1axrA           KKTIFDFYELEPHKFQNKTNGITPRRWLVLCNPG--LAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR
3e3nF           RIHSELKKTIFKDFYELEPHKFQNKTNGITPRRW--------LVLCNPGLAEIIAERIGEEYISDLDQLR
3bjqF           DPA-KYNADHKVKLVGSARWTSPDSDPTKDVETA--------KEAIADSIGEPNRLLSRKALSACKYHPK
2d5bA           YIQENIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTFVWFD---ALLNYVSALDYPE
3bjqI           ------NADHKVKLVGSARWTSPDSDPTKDVETA--------KEAIADSIGEPNRLLSRKALSACKYHPK
2c1wC           GYVARDEDDQVLNLQFNWKEMVKPVGSSFIGVSPEFEFALYEKMSREVVRLEEYELQIVVNRH-------
2d54A           ENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTAVWFDALLNYVS---ALDYPE
2ajgA           ----------------------EGVEITFN--VNDYDNTLT------VYTTRPDTFMGCTYLAVAAGHPL
1a8hA           ENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFD---ALLNYVSALDYPE
2c1wB           NKSRPDEDDQVLNLQFNWKEMVKPVGSSFI--GVSPEFEFAEKMSREVVRLEEYELQIVVNRYIGTAYPV
1bs2A           KGAVLIDLTKFNKKLGKAI-------VQKSDGTTLYLTRDVGAAMDRYEKYHFDKMIYVIASQQDLHAAQ
3dpgA           TSTPDLAVVVLPEEFQNDEMWREEIAGLTRPN-------QILLSGAYQRLQGRVQPGEISAFKRSLRSDR
2ajhB           ----------------------EGVEITFN--VNDYDNTLT------VYTTRPDTFMGCTYLAVAAGHPL
2ajgB           ----------------------EGVEITFN--VNDYDNTLT------VYTTRPDTFMGCTYLAVAAGHPL
2bvtA           ----------------------------------------------------------------------
3c8zB           LWRAERPGEPSWPSPFGR----------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           CIPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAG--VVEGNPIMEIAKYFLEYPLTIKRPE
1b80A           ----------------------------------------------------------------------
2csxA           RPSRVKWGIPVPFDPEHTIYVWFDALFNYIS---------------------------------------
2c1fA           VSDHFEWAKQGWGIGNLYALNAEGWQSSGVADVTLLDV--------------------------------
3bicB           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2dlcX           DVDCQGVDQRKIFVLAEENLPSLG------------------YKKRAHLMNPMVPGLANSKIDLLEEPKQ
2ct8A           ----------------------------------------------------------------------
1d2rA           RYELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPK-------AYITLLDDAKTIEKKIKSAVTDSEGT
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
3d6uA           CIPVLTGLDGEGKMSSSKGNFIAV--DDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPE
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           GLD--GEGKMSSSKGNFIA------VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPE
2azxA           IQCLIPAIDQDPYFRTRDVAPRIGYPKPALLHFPALQGAQTKSASDPNSSIFTDTAKQIK----------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           SSVCLHTPILVGLDGQKMSSSKGNYISVRPEEVERKIRKAYCPAGVVEENPILDIAKYHILPRFGKIVVE
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           NPNEFIDMTIRGQNVRLYIIPGISLDTRFEIS----KIEWHNLMDLPTFKMKNKFYMVIPFLAPLKKWIK
2e50B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
3bjqH           KY----NADHKVKLVGSARWTSPDSDPTK--DVETAKEAI------ADSIGEPNRLLSRKALSACKYHPK
2cycA           ----------------------------------------------------------------------
3bjqE           HEHECAQIALDPAKYNADHKVKLVGSARWTSPDSDPTKDVTAKEAIADSIGEPNRLLSRKALSACKYHPK
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           DDRQIEWQDLVRGRVSWQGADLGGDMVIARAAPRGEIG----YPLYNLVVVVDDIAMGITDV--------
2an2A           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2ct8A           TRPRSVKWGIPVPFDPEHT---------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMG
2bteA           ELAAPEKREEVLAYVEAAKRKTEIERQAEGREKTGVFLGAYALNPATGERIPIWTADYVLFGYGTGAIMA
1abbA           LLSYVDDEAFIRDVAKVKQENKLKFAAYLEREVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK
1c8kA           KLL-------SYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLH
2amvA           VDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP
1axrA           DVAKVKQENKLKFAAYLEREYKVHINPNS--------LFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEP
3e3nF           KLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYK-------VHINPNSLFDVQVKRIHEYKRQLLNCLH
3bjqF           LIEITIDLKA-------------------LWEVEEIVVGTARVATD-----------SFGDVWGPDVWLG
2d5bA           GEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGPDGRKMSKTLGNVVDPFA---LLEK
3bjqI           LIERVSITIDLKALWEVEEIV-------------------VGTARVATSFGDVWGPDV-----WLGYVSD
2c1wC           ----------------------------------------------------------------------
2d54A           GEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNLGPDGRKMSKTLGNVVDPFA-------
2ajgA           AQKAAENNPELAAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMA
1a8hA           GEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGPDGRKMSKTLGNVVDPFA-------
2c1wB           LLSTN-----------------------------------------------------------------
1bs2A           FFEILK----------------------------------------------------------------
3dpgA           LYQPLYEANVMQLLLEGKL---------------------------------------------------
2ajhB           AQKAAENNPELAAFIDECR----------TMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMA
2ajgB           AQKAAENNPELAAFIDECRN-----------EKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMA
2bvtA           ------------------------------------------IAIVDADATARSLLSYLDGVRGEGIL--
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           KFGGDLTVNSYEELESLFKNKELHPMDL------------------------------------------
1b80A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           ----------------------------------------------------------------------
3bicA           ----------------------------------------------------------------------
3cglD           ----------------------------------------------------------------------
2dlcX           VKKKINSAFCSPGNVEENGLPIQELKFGTNHFEFFIDRPEKFGGPITYKSFEEMKLAFKEEKLSPPDLKI
2ct8A           --------------------------------------------------------------YVNDVPHL
1d2rA           IRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGK----------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
3d6uA           KFGGDLTVNSYEELESLFKNKELHPMDL------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           --------------------------------------NNQSGLRDYWALSVLCGADPEGVFLPAQAQSL
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           KFGGDLTVNSYEELESLFKNKELHPMD-------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           RDAGDVEYASFEELAEDFKSGQLHPLDLKIA---------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           KRNIAN----------------------------------------------------------------
2e50B           -----------IEHIDEVNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKPNFWVTTFVNHPQV
3c98A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3ecjA           -------------LDHFNQVTPDVPRGRKYLEDLGFRVTEDIQDDEGTTYAAWMHRKGTVHDTALTGGNG
3bjqH           LIEITIDLKALW-------------------EVEEIVVGTARVATGNDSFGDVWGPDVWL-----GYVSD
2cycA           ----------------------------------------------------------------------
3bjqE           LIERVKYT----------RAESITIDLKALWEVEEIVVGTARVA--TDSFGDVWGPDVWLG-----YVSD
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           --------------------------------------------------------------YVNDVPHL
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYXXXXXXXXXXXX
2bteA           VPAHDQRDYEFARKFGLPIKKVIERPGEPLPEP--LE-RAYEEPGIMVNSGPFDGTESEEGKRKVIAWLE
1abbA           EPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRV------------
1c8kA           VITLYNRIKKEPNKFVVPR--TVMIGGKAAPGYHMAKMIIKLIT--AIGDVVNHDPVVGDRLRVIFLENY
2amvA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVS-------------
1axrA           NKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVS-------------
3e3nF           VITLYNRIKKEPNKFVVPRTVMI----GGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENY
3bjqF           YVSDNPDPSVEEPSFGYTYQIEGHPLVEVPYWD---------NNAKSWIYGVSDDN--------------
2d5bA           YGRDALRYYLLRE---------------------------------------------------------
3bjqI           NPDPSVEEPSFGYTYQIEGHPLVEVPYWDNNAKSWIYGV--SDDNTPALSGLAGYL--------------
2c1wC           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           VPGHDQRDYEFASKYGLNIKPVILAADGSEPD---LSQQALTEKGVLFNSGEFNGL--------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
2ajhB           VPGHDQRDYEFASKYGLNIKPVILAAD-GSEPDLSQQAL--TEKGVLFNSGEFNGL--------------
2ajgB           VPGHDQRDYEFASKYGLNIKPVILAAD-GSEPDLSQQAL--TEKGVLFNSGEFNGL--------------
2bvtA           FGHQHTTSFGLTTGPTDGTTSDVKNVTGDFPAVFGWDTLEGNERPGLAENTRDENI--------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           -------------------------------HPEWAKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDL
3bicA           -----------------------------------AKKQLKGKNPEDLIWHTPEGISIKPLYSKRDTMDL
3cglD           ----------------------------------------------------------------------
2dlcX           GVADAINELLEPIRQEF-----------------------------------------------------
2ct8A           GHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERWEFLKIEYTKFIR
1d2rA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           LRRLKTTHFEPGSHYSYCNGNFRILADLIEAHTG--RTLVDILSERIFAPAGMKRAELISDTALFDECTG
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2e50B           SALLGEEDEEAMHYLTRVEVTEFEDIK-----------------------SGYRIDFYFDENPYFENKVL
3c98A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3ecjA           PRLHHVAFSTHEKHNIIQICDKMGALRISDRIERGPGRHG-------VSNAFYLYILDPDNHRIEIYTQD
3bjqH           NPDPSVEEPSFGYTYQIEGHPLVEV---------------------------------------------
2cycA           ----------------------------------------------------------------------
3bjqE           NPDPSVEEPSFGYTYQIEGHPLVEVPY-------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           -EEVADRLDSIKLTGSYVHTKEELEHAWRNSNRCIGRLFWNSLNVIDRRDVRTKEDVRDALFHHIETATN
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           -SNIGQHDLDTKSKQIQQW---------------------IEKKYHVQVTIKRRKDAEQSEEETEEIFNQ
2d5bA           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           GHAYTTIAADTIARYYRLRDYDVFFLTGTDEHGLKIQKKAEELGISPKELVDRNAERFKKLWEFLKIEYT
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFL
2bteA           EKGLGKGRVTYRLRDWLISRQRYWGTPIPMVHCEACGVVPVPEEELPVLLPDEDIRPKGKSPLEAHPEFY
1abbA           --SLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRV---
1c8kA           RVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG---------------ANVEMAEEA
2amvA           ---LAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMD----------------------GAN
1axrA           ---LAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMD---------------GANVEMAEEA
3e3nF           RVSLAEKVIPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEE--NFFIFGMRVED
3bjqF           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           ---ALFADYIRKADAIGGVNTVSAHVENFVTGGSFYDTSGDTLRAVLPLADASRRDDGTLIPIVFRPWHE
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
1b80A           ----------LSNCPGAPQMNFFTGRAPA-TQPAPDGLVPEPFHTVDQIINRGEFDELE-LVMLSAHSVA
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           PEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIK-----------------QQGLSV
3bicA           PEELPGVKPFTRGPYPTMYTFRPWTIRQYAGFSTVEESNKFYKDNIKQQGLS-----------------V
3cglD           ------------------------------------------KEEMLIDLHLEGTFNGHYFEIKGKGKGQ
2dlcX           ----------------------------------------------------------------------
2ct8A           TTDPYHVKFVQKVFEECYKRGDIYLGEYEKEPSYFFRLSKYQDKLLELYEKNPEFIPDYRRNEIISFVKQ
1d2rA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ----------------------------------------VIKEEMLIDLHLEGTFNGHYFEIKGKGKGQ
2aelB           ----------------------------------------------------------------------
1cjyB           ---------------TTLSSLKEKVNTAQCPLPLFTCLHVDVSELMFADWVEFSPYEIGMAKYGTFMAPD
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           --------------------------PIQAPEISKCVVPPAD-------LPPGAVVDNCCPPVASNVDYK
3d6uA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           YEGDTVRGFLPATRIQWMGDAGICASLNDMIAWEQFIDATRDDESGLYRRLSGPQTFKDGVAAPYGFGLN
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2e50B           SKEFHMSSKSTEIKWK-------SGKDMFFTWFTGAD--ELGEVIKDDIWPNPL----------------
3c98A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           --------------------------------------------------------DGKGKPYEGEQTVK
3ecjA           YYTGDPDNPTITWNVHDNQRRDWWGNPVVPSWYTEASKVLDLDGNVQEIILRTDDS------------EL
3bjqH           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           NGKIRPSITIFPPEEKGEKQVEIWNHQLIRYAGYEGEAIGDPASCSLTAACEQLGWRGERTDFDLLPLIF
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ILQTMPDIFSSRPKAIRGGTA--SMCVF------------------------------------------
2d5bA           ----------------------------------------------------------------------
2d54A           ------------------------------------------------------------------ISRP
1a8hA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           KFIRTTDPYHVKFVQKVFEECYKRGDIYLGEYKEPSYFFRLSKYQDKLLELYEKNPEFIQPDYRRNEIIS
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           -----------------------------------------------------------------LSRDY
2cfoB           ----------------------------------------------------------------------
2cfoA           --------------------------------------------------------------------AL


                         *         .         .         .         .         +         .:560
query           ECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFW
2bteA           ETTCPKCGGPAKRDTDTMDTFFDSSWYYLRYTDPNDRLPFDEKANAWMPVDQYIGGVEHAVLHLLYSRFF
1abbA           --EDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQP--DLFKDIVNMLMHHDRFKVFADYEEYV
1c8kA           GEENFFIFGMRVEDVDRLDQRGYNAQEYYDRELRQIIEQLSSGFFSPKQPDLF-----KDIVNMLMHHDR
2amvA           VEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH
1axrA           GEENFFIFGMRVEDVDRLDQRGYNAQEYYDRELRQIIEQLSSGFFSPKQPDLF-----KDIVNMLMHHDR
3e3nF           VDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSP-----KQPDLFKDIVNMLMHHDRFKVFADYEEYVK
3bjqF           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           NAGSWFWWGAATVEYLRDVKGVSNFLYA--WGPGGGFGGNRDVYLRTYPGDAFVDVLGLDTYDSTGSDAF
3c8zB           ----------------------------------------------------------------------
3c8zA           -GKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHVECSAIA-LTRIGTGLDIQGGGSDLIFPHHEYSAAH
2ag6A           ----------------------------------------------------------------------
1b80A           AVNDVDPTVQGLPFDSTPGIFDSQFFVETQLRTAFPGSGGNQPGEIRIQSDHARDSRTACEWQSKLVDDF
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           AFDLATHRGYDSDNPRVRGDVGMAGVAIDTV------------------------EDTKILFDGIPLEKM
3bicA           AFDLATHRGYDSDNPRVRGDVGMAGV-------------------AIDTVEDTKILFDGIPLEKMSVSMT
3cglD           PNEGTNTVTLEVTKGGPLPFGWHILCPQFNKAFVHHPDIHDYLKLSFPEGYTWERSMHFEDGGLCCITND
2dlcX           ----------------------------------------------------------------------
2ct8A           GLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYILEDKVEIYWPADLHLVGKDILRFHTVYWPAF
1d2rA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           PNEGTNTVTLEVTKGGPLPFGWHPQFNKAFVHHPD--NIHDYLKLSFPEGYTWERSMHFEDGGLCCITND
2aelB           ----------------------------------------------------------------------
1cjyB           LFGSKFFMGTVVKKYEENPLFLMGVWGSAFSILFNRVLG---STMEEELENITTKHIVSWIHRMIMALVS
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           --LPAVTTMKVRPAAHTMDKD-AIAKFAKAVELMKALPCAYCNGGYDQVNFPDQEIQVHFPFHRWYLYFY
3d6uA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           LHETGGKRLTGHGGALRGWRCQ--RWHCADERLSTIAMFNFEGGASEVAFKLMNIALGVSSSEVSRVEAD
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           LT--VTKGGPLPFAWDILSPQ----CSIPFTKYPEDIP---DYVKQSFPEGFTWER------IMNF--ED
3ecjA           EVTIGADGFSFTRAGDEDGSYHGQASKG------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           RMK--GDEQPVWYELPR-SLVIEVPITHPDI---EAFSDLELKW-YGVPMKLEVGGIHY-----------
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           KSRVPWGIPLPWDENHVTFVWFDALLNYVSALDY----PEGEAYRTFWPHAWHLIGKDILKPH---AVFW
2d54A           KSRVPWGIPLPWDENHVTAVWFDALLNYVSAL----DYPEGEAYRTFWPHAWHLIGKDILKPH---AVFW
1a8hA           KSRVPWGIPLPWDENHVTYVWFDALLNYVSALDY----PEGEAYRTFWPHAWHLIGKDILKPHAVFWPTM
3c8zB           -GKSDQLDALLWRAERPGEPSWPSPFGRGRPGWHVECSAIA-LTRIGTGLDIQGGGSDLIFPHHEYSAAH
2ag6A           ----------------------------------------------------------------------
2csxA           GLKDLSVTRPRSRVKWGIPVPFDPEHTIYVWFDALFNYISALEDKVEIPADLHLVGKDILRFHTVYWPAF
2ct8A           ----------------------------------------------------------------------
3d6vA           ---------------KRARRSMELIAREDENPKVAEVIYPIVNPLHYEGVDVAVGGMEQRKIHMLARELL
2cybB           VLDVLKMARITTLNRARRSMDEVSRRKEDPMVSQMIYPLMQALDIAHLGVDLAVGGIDQRKIHMLARENL
2cfoB           -CYCTPEELEALRAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVS
2cfoA           RAEQKAKGQAPRYDNRHRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVSWQGADLGGDMVI


                         .         .         .         *         .         .         .:630
query           TKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVV
2bteA           TKFLHDLGMVKVEEPFQGLFTQGMVLAWTDFGPVEVEGSVVRLPEPTRIRLEIPESALSLEDVRKMGALH
1abbA           KCQERVSALYKNPREWTNIATSGKFSSDRTIAQYA--REIWVEPSRQRL---------------------
1c8kA           FKVFADYEEYVKCQERVSALYKNPREWTRMVIRNSSDRTIGVEPSRQRLP--------------------
2amvA           HDRFKVFADYEEYVKCQERVSALYKNPREWTR--------------------------------------
1axrA           FKVFADYEEYVKCQERVSALYKNPREWTRMVIRNIYAREIWVEPSRQRLPAPDEKIP-------------
3e3nF           CQERVSALYKNPREWTRM----------------------------------------------------
3bjqF           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           LAGLVADLRMIAEIDEKGKV----------------------------SAFTEFGVSGGVGTNGSS---P
3c8zB           ----------------------------------------------------------------------
3c8zA           AESVTG------ERRFARHYVHTGMIGVLV----------------------------------------
2ag6A           ----------------------------------------------------------------------
1b80A           QFIFLALT---------QLGQDPNAM----------TDCSDVIPQSKPIPGPFSFFPAGKTIKDVEQAC-
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           SVSMTM------NGAVIPVLANFIV---------------------------------------------
3bicA           MN-----------GAVIPVLANFIV---------------------------------------------
3cglD           ISLT-------GNCFYYDIKFTGLNFPP------------------------------------NGP---
2dlcX           ----------------------------------------------------------------------
2ct8A           LMSL-------GYELPKKVFAHGWWTVEG-----------------------------------------
1d2rA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ISLT-------GNCFYYDIKFTGLNFP------------------------------------PNG----
2aelB           ----------------------------------------------------------------------
1cjyB           DSALFNT------REGRAGKVHNFMLGLNDVKSKKIH---------------------------------
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           ERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPPV------------------
3d6uA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           SAWFGSWLDDETGLVLSLEDAGHGRMKARFGT-------SPEMMDVVSANEARSAVTTIRRDGETIELVR
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
3c98A           ----------------------------------------------------------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           GAVCTVSNDSSIQGFTYHVKFSGLNFPP------------------------------------NGP---
3ecjA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           PTMLKAAG----IPMYRHLNVGGFLLGP------------------------------------DGR---
2d54A           PTMLKAAG----IPMYRHLNVGGFLLGPDG----------------------------------------
1a8hA           LKAA-------GIPMYRHLNVGGFLLGPDG----------------------------------------
3c8zB           AESVTG------ERRFARHYVHTGMIGVLVS---------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           LMSLGYE--------LPKKVFAHGWWTVEGKK--------------------------------------
2ct8A           ----------------------------------------------------------------------
3d6vA           PK------------KVVCIHNPVLTGLDGEGKMSSSKGNFIA-------VDDSPEEIRAKIKKAYCPA--
2cybB           PR---------LGYSSPVCLHTPILVGL------------------------------------DGQ---
2cfoB           WQGADLGGDMVIARAAPRGEIGYPLYNLVVVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNFA
2cfoA           ARAAPRGEIGYPLYNLV------------VVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNFA


                         .         +         .         .         .         .         *:700
query           IGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGYANAQA
2bteA           LWKPAVMSKSKGNGVMVGPFVKEQGADIARITILFAAPPENEMVWTEEGVQGAWRFLNRIYRRVAEDREA
1abbA           ----------------------------------------------------------------------
1c8kA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           AQWFTKVLAAIKADPVASRNATWANFDAGQHFVPDALLEDFQAYAADPFT----LFASEVTGA-FDRTVA
3c8zB           ----------------------------------------------------------------------
3c8zA           ----SQLRAQG------------VDPSAIRLGLF-SGHYREDRFWSNEVLDEANARLARWRSEAPDATDV
2ag6A           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           --------TGEEQGVPKEKLTGTIQNDILKEFMVRNTYIF-PPEPSMKIIADIFEYTAKHMPFNSISISG
3bicA           --------TGEEQGVPKEKLTGTIQNDILKEFMVRNTYIF-PPEPSMKIIADIFEYTAKHMPFNSISISG
3cglD           -----VVQKKTTGWEPSTERLYPRDGVLIGDIHHALTVEGGGHYA--CDIKTVYRAKKAALK--------
2dlcX           ----------------------------------------------------------------------
2ct8A           ----KKMSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRGELANEIGNYSRVVNMA
1d2rA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ----PVVQKKTTGWEPSTERLYPRDGVLIGDIHHALTVEGGGHYA--CDIKTVYRAKKAALK--------
2aelB           ----------------------------------------------------------------------
1cjyB           ----VVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPS-----DSSPPFKELLLAEKWAKMNKLPFPKI
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           ASENLRLSMKRVKGEAKHDIIGRYHSDELDADLLLVSEGGAIYGAFEGFLGKSDMYPLYSVGSDVWLLPV
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
3c98A           ---VYLITPSEKSVHSLSDFKDPPTAKYRAAHVFFTDSCPDALFNVKSRAAKVIKTLTEINIAFLPYESQ
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           -GWI-TISKKGKYLLYELGIEHIRDIQLLYKIKNIKDGTIKECKFNVRNKNHLKNIIIPIFNKTNKHYDY
2arlA           -----VMQKKTQGWEPSSERLFARGGMLIGNNFMALKLEGGGHYL--CEFKTTYKAKKPVKMPGY-----
3ecjA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           -----KMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYELADDLGNVQRTRAML
2d54A           ----RKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYELADDLGNVQRTRAML
1a8hA           ----RKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYELADDLGNVQRTRAML
3c8zB           -----QLRAQG------------VDPSAIRLGLFS-GHYREDRFWSNEVLDEANARLARWRSEAPDATDV
2ag6A           -----KMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPEKF-------
2csxA           ------MSKTLGNVVDPYEVVQEYGLDEVRYFLLREVPFGQDGDFSKKAILNRGELANEIGNLYSRVVNM
2ct8A           ----------------------------------------------------------------------
3d6vA           ------GVVEGNPIMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNK-----------------
2cybB           -----KMSSSKGNYISVRDPPEEVERKIRKAYCPAGVVEEN-----------------------------
2cfoB           HTPLQKLSKRDGVTSISDFRAMGYLAPALANYMTLLGWSPPEGVGELFTLDLAAKHFERINKAGARFDWD
2cfoA           HTPLQKLSKRDGVTSISDFRAMGYLAPALANYMTLLGWSPPEGVGELFTLDLAAKHFERINKAGARFDWD


                         .         .         .         .         +         .         .:770
query           IRXXXXXXXXXXXXXLRREIHTVLKQANYDYERIQYNTVVSATMKMLNALEDAKTASPAGRREGFSVLLR
2bteA           LLVFQAEALEGKDRELYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYDRPVTPVYRTAIRYYLQ
1abbA           ----------------------------------------------------------------------
1c8kA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           AA--------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           IRVRQYLADDLDTPKALAALDGWCTDALSYGGHDTESPRL------------------------------
2ag6A           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           YH---MQEAGADAILELAYTLADGLEYSRTGLGLTIDEFAPRLSFFWGIGHLIEKMFQPKNSKSLLLRAH
3bicA           YH---MQEAGADAILELAYTLADGLERTGLQAGLTIDEFAPRLSFFWGIGMNFYMEIAKMRSGWSLTEQD
3cglD           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2ct8A           HKFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLKEELQKVLYALVDGLFVLTH
1d2rA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
1cjyB           DPYVFDREGLKECYVFKPDCPTIIHFVLANINFRKYAPGVPRETEEEKEIAD------------------
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           QRSMDAPSPGEWKLVFRRDDKGEITGGCWLARGVEYRRVQ------------------------------
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
3c98A           VYSLDSADSFQSFYSEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAMGEGPDKARSQLLILDR
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           LYFKDNLLKDIKYYNDLSYYLRPIKPFNTTEDILNKNYFSSWLIGFFEAK--------------------
2arlA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           FRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALPEEARAVLYRVVEGLRIASI
2d54A           FRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALPEEARAVLYRVVEGLRIASI
1a8hA           FRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALPEEARAVLYRVVEGLRIASI
3c8zB           IRVRQYLADDLDTPKALAALDGWCTDALSYGGHDTESPRLATTVDALLGV--------------------
2ag6A           ----------------------------------------------------------------------
2csxA           AHFLGGEVSGARDEEYAKIAQESIKNYENYMEKVNFYKAIEEILKFTSYLKEELQKVLYALVDGLFVLTH
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           KWLNRQYIQQLEPEEFLAELIPLWQGAGYAFDEERDRPWLFDLAQLLQPGEAMAQLGQPQSATILAYLLE
2cfoA           K--------------LNWLNRQYIQQLEPEEFLAELIPLWQGAGYAFDEERDRPWLFD------------


                         .         .         *         .         .         .         .:840
query           VLYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVRGSLTVPxxxxxxxxx
2bteA           MLFPFAPHLAEELWHWFWPD----SLFEAGWPELDEKALEKDVVEVAVQVNGRVRGTIHIP---------
1abbA           ----------------------------------------------------------------------
1c8kA           ----------------------------------------------------------------------
2amvA           ----------------------------------------------------------------------
1axrA           ----------------------------------------------------------------------
3e3nF           ----------------------------------------------------------------------
3bjqF           ----------------------------------------------------------------------
2d5bA           ----------------------------------------------------------------------
3bjqI           ----------------------------------------------------------------------
2c1wC           ----------------------------------------------------------------------
2d54A           ----------------------------------------------------------------------
2ajgA           ----------------------------------------------------------------------
1a8hA           ----------------------------------------------------------------------
2c1wB           ----------------------------------------------------------------------
1bs2A           ----------------------------------------------------------------------
3dpgA           ----------------------------------------------------------------------
2ajhB           ----------------------------------------------------------------------
2ajgB           ----------------------------------------------------------------------
2bvtA           ----------------------------------------------------------------------
3c8zB           ----------------------------------------------------------------------
3c8zA           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
1b80A           ----------------------------------------------------------------------
2csxA           ----------------------------------------------------------------------
2c1fA           ----------------------------------------------------------------------
3bicB           CQTSGWSLTEQDPYNNIV---RTAIEAMAAVFGGTQSLHTNSFDE-------------------------
3bicA           PYNNIVRTAIEAMAAVFG---GTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIP----------
3cglD           ----------------------------------------------------------------------
2dlcX           ----------------------------------------------------------------------
2ct8A           LLYPITPNKMKEALQMLG---EKEFLKELKPYSKNTYKLGERKILFP-----------------------
1d2rA           ----------------------------------------------------------------------
3egbB           ----------------------------------------------------------------------
3e3nB           ----------------------------------------------------------------------
3cglC           ----------------------------------------------------------------------
2aelB           ----------------------------------------------------------------------
1cjyB           ----------------------------------------------------------------------
2aelA           ----------------------------------------------------------------------
3dl5B           ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
3d6uA           ----------------------------------------------------------------------
2bcvA           ----------------------------------------------------------------------
2aekA           ----------------------------------------------------------------------
1ei5A           ----------------------------------------------------------------------
3e3nD           ----------------------------------------------------------------------
3e3nH           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2azxA           ----------------------------------------------------------------------
3e3nA           ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2bcrA           ----------------------------------------------------------------------
3c5fA           ----------------------------------------------------------------------
2bcqA           ----------------------------------------------------------------------
2a6tA           ----------------------------------------------------------------------
2e50B           ----------------------------------------------------------------------
3c98A           GFDPSSPVLHELTFQAMSY---DLLPIENDVYKYETSGIGEARVKEVL----------------------
2c1sA           ----------------------------------------------------------------------
3cfiJ           ----------------------------------------------------------------------
2ab5B           ----------------------------------------------------------------------
2arlA           ----------------------------------------------------------------------
3ecjA           ----------------------------------------------------------------------
3bjqH           ----------------------------------------------------------------------
2cycA           ----------------------------------------------------------------------
3bjqE           ----------------------------------------------------------------------
3ci0I           ----------------------------------------------------------------------
2cfoB           ----------------------------------------------------------------------
2cfoA           ----------------------------------------------------------------------
2an2A           ----------------------------------------------------------------------
1b25A           ----------------------------------------------------------------------
2cybA           ----------------------------------------------------------------------
2c1qA           ----------------------------------------------------------------------
3e4cB           ----------------------------------------------------------------------
3e4cA           ----------------------------------------------------------------------
3d5hA           ----------------------------------------------------------------------
1bdgA           ----------------------------------------------------------------------
2crqA           ----------------------------------------------------------------------
2d5bA           LLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL------------------------
2d54A           LLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL------------------------
1a8hA           LLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL------------------------
3c8zB           ----------------------------------------------------------------------
2ag6A           ----------------------------------------------------------------------
2csxA           LLYPITPNKMKEALQMLG---EKEFLKELKPYSKNTYKLGERKILFP-----------------------
2ct8A           ----------------------------------------------------------------------
3d6vA           ----------------------------------------------------------------------
2cybB           ----------------------------------------------------------------------
2cfoB           HLPAEPALTVAMGQQLIQQAAKAAGVKKGAT---------------------------------------
2cfoA           -----LAQLLQPGLNTLREAIDQGAVFFIPSVTFDSEAMAQLGQPQSATILAYLL---------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2bteA           ---------------------------------
1abbA           ---------------------------------
1c8kA           ---------------------------------
2amvA           ---------------------------------
1axrA           ---------------------------------
3e3nF           ---------------------------------
3bjqF           ---------------------------------
2d5bA           ---------------------------------
3bjqI           ---------------------------------
2c1wC           ---------------------------------
2d54A           ---------------------------------
2ajgA           ---------------------------------
1a8hA           ---------------------------------
2c1wB           ---------------------------------
1bs2A           ---------------------------------
3dpgA           ---------------------------------
2ajhB           ---------------------------------
2ajgB           ---------------------------------
2bvtA           ---------------------------------
3c8zB           ---------------------------------
3c8zA           ---------------------------------
2ag6A           ---------------------------------
1b80A           ---------------------------------
2csxA           ---------------------------------
2c1fA           ---------------------------------
3bicB           ---------------------------------
3bicA           ---------------------------------
3cglD           ---------------------------------
2dlcX           ---------------------------------
2ct8A           ---------------------------------
1d2rA           ---------------------------------
3egbB           ---------------------------------
3e3nB           ---------------------------------
3cglC           ---------------------------------
2aelB           ---------------------------------
1cjyB           ---------------------------------
2aelA           ---------------------------------
3dl5B           ---------------------------------
1bt1A           ---------------------------------
3d6uA           ---------------------------------
2bcvA           ---------------------------------
2aekA           ---------------------------------
1ei5A           ---------------------------------
3e3nD           ---------------------------------
3e3nH           ---------------------------------
3d6vA           ---------------------------------
2azxA           ---------------------------------
3e3nA           ---------------------------------
1a1xA           ---------------------------------
2cybB           ---------------------------------
2bcrA           ---------------------------------
3c5fA           ---------------------------------
2bcqA           ---------------------------------
2a6tA           ---------------------------------
2e50B           ---------------------------------
3c98A           ---------------------------------
2c1sA           ---------------------------------
3cfiJ           ---------------------------------
2ab5B           ---------------------------------
2arlA           ---------------------------------
3ecjA           ---------------------------------
3bjqH           ---------------------------------
2cycA           ---------------------------------
3bjqE           ---------------------------------
3ci0I           ---------------------------------
2cfoB           ---------------------------------
2cfoA           ---------------------------------
2an2A           ---------------------------------
1b25A           ---------------------------------
2cybA           ---------------------------------
2c1qA           ---------------------------------
3e4cB           ---------------------------------
3e4cA           ---------------------------------
3d5hA           ---------------------------------
1bdgA           ---------------------------------
2crqA           ---------------------------------
2d5bA           ---------------------------------
2d54A           ---------------------------------
1a8hA           ---------------------------------
3c8zB           ---------------------------------
2ag6A           ---------------------------------
2csxA           ---------------------------------
2ct8A           ---------------------------------
3d6vA           ---------------------------------
2cybB           ---------------------------------
2cfoB           ---------------------------------
2cfoA           ---------------------------------