[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF06949.1

[Show Plain Result]


## Summary of Sequence Search
    1::339
    7::271     5e-62  55%  271 aa  PF02626 AHS2 "Allophanate hydrolase subunit 2"
    1::339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxSGAADDLALRVGNRLLGNDPGAAAIEFTLGRAAVRFEADMRV
PF02626         ----------------------------SGAMDRLALRLANRLVGNPEDAAALEITLGGPTLRFHGDTVI


                         .         .         *         .         .         .         .:140
query           ALTGAECSANLDGVPVWSWHAFDVRRGETLTLPSPRGGTRTYLCVAGGIDVPLVMNSRSTDLKSGFGGFE
PF02626         ALTGADMEATLDGEPVPPWRPFLVKAGQVLTLGAPKAGLRAYLAVAGGIDVPPVLGSRSTDLLSGIGGLE


                         +         .         .         .         .         *         .:210
query           GRVLREGDRLPVGRPGIEQGQDWVGVAAPGWALPGQDGGNAIAIRLLPGPEYADFEPASQAALWQSEWTI
PF02626         GRALKAGDVLPLGAPTAAAPE---LAALPAALIP--DYGDEWELRVVPGPQYDWFTEESIEAFFSTEWTV


                         .         .         .         +         .         .         .:280
query           TPQSNRMGLRLQGPALARRAERSADLLSHGVVPGVMQVPPSGQPIALMSDAQTTGGYPKIGTVIGADLWR
PF02626         SPNSDRMGYRLEGPPLER--AHPSEILSEGVVPGAIQVPPDGQPIVLLADRQTTGGYPKIATVISADLWK


                         .         *         .         .         .         .         +:350
query           LAQVPLGATVRFRQVTLEEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02626         LAQLRPGDKIRFVPVSLEEA---------------------------------------