[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF06971.1

[Show Plain Result]


## Summary of Sequence Search
    1::85
    1::85      5e-29  62%   85 aa  PF12091 DUF3567 "Protein of unknown function (DUF3567)"
    1::85

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQMIYNSDNYCIVEFGADVEHATLASGGYEIVDKNLKREIFLGGLMAETFRADVTRLIESEPSVEEVDEF
PF12091         MQMIYNSDNYCVVEFAPDDGHPALNRGGYEIVDKNAQREIFLDGSLAERFREHVKALIQDEPTLEEVDDF


                         .         .         *         .         .         .         .:140
query           LGKFDTVMNNPLVMH
PF12091         LGQYDSLMQQPVVLH