[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07116.1

[Show Plain Result]


## Summary of Sequence Search
    1::444
    1::167     8e-54  62%  168 aa  PF00158 Sigma54_activat "Sigma-54 interaction domain"
    1::101     2e-14  34%  111 aa  PF00072 Response_reg "Response regulator receiver domain"
    2::42      2e-07  51%   42 aa  PF02954 HTH_8 "Bacterial regulatory protein, Fis family"
   10::97      2e-04  33%  160 aa  PF07724 AAA_2 "AAA domain (Cdc48 subfamily)"
    1::444

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLL
PF00158         ----------------------------------------------------------------------
PF00072         ---------ILIVDDDPVNRELLKRLLEKLGYVVTTAEDGEEALELLEEHRPDLVLLDINMPGMDGLELL
PF02954         ----------------------------------------------------------------------
PF07724         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00158         ----------------------------------------------------------------------
PF00072         RRIRELEPDIPIIVLTAYDDEEDAVRALEAGADDYLTKPF------------------------------
PF02954         ----------------------------------------------------------------------
PF07724         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxIIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPE
PF00158         -------LIGRSPAMQRLLEQIKRVAPSDAPVLITGESGTGKELVARAIHELSPRADGPFVAVNCAAIPE
PF00072         ----------------------------------------------------------------------
PF02954         ----------------------------------------------------------------------
PF07724         -----------------------------------GPTGVGKTELAKTLAKLLVGSEKPLIRIDASEYTE


                         .         .         .         +         .         .         .:280
query           SIFESEMFGHEAGAFTGAGKRRVGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPI
PF00158         ELLESELFGHEKGAFTGAVRRRKGLFEQADGGTLFLDEIGELPLELQAKLLRVLQEGEFRRVGGTKPIKV
PF00072         ----------------------------------------------------------------------
PF02954         ----------------------------------------------------------------------
PF07724         G----EDVEHSVSRLIGAPPGYVG---YEEGGIVLLDEIDKAHPGVQNALLQILEGGRL-----------


                         .         *         .         .         .         .         +:350
query           DVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00158         DVRIIAATNRDLEELVAEGRFREDLYYRLNVVPI------------------------------------
PF00072         ----------------------------------------------------------------------
PF02954         ----------------------------------------------------------------------
PF07724         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMERYERAVIADTLARTGGA
PF00158         ----------------------------------------------------------------------
PF00072         ----------------------------------------------------------------------
PF02954         ---------------------------------------------------LEEVERELIEQALERTGGN
PF07724         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VSQAADLLQVGKATLYDKIKRYxx
PF00158         ------------------------
PF00072         ------------------------
PF02954         KSRAAELLGISRATLYRKLKKY--
PF07724         ------------------------