[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07164.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
    3::56      2e-08  44%   56 aa  PF03861 ANTAR "ANTAR domain"
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03861         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03861         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxDATKLKLAERKTVERAKGLLMQARGISEDEAFKRLRSMAMERGIRLVDA
PF03861         ---------------------EALRRALESRKLIERAKGILMERNGLSEDEAFRLLRKLSMDSGTKLREV


                         .         .         .         +         .         .         .:280
query           AQRVIxxxx
PF03861         AEAIL----