[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07169.1

[Show Plain Result]


## Summary of Sequence Search
    1::454
    1::178     5e-14  30%  180 aa  PF05193 Peptidase_M16_C "Peptidase M16 inactive domain"
   83::140     1e-05  33%  145 aa  PF00675 Peptidase_M16 "Insulinase (Peptidase family M16)"
    1::454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05193         ----------------------------------------------------------------------
PF00675         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05193         ----------------------------------------------------------------------
PF00675         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGxxxxxxxxxSIT
PF05193         -------------------------------------------------------------------AIT
PF00675         EEALDLLADFVLNPLFTEEELERERGVILEEIREVDDEPDELAFENLHAAAFRNHPLG------------


                         .         .         .         +         .         .         .:280
query           HDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQ
PF05193         LEDLKDFYKKFYTPDNMVLVIVGDVDPEELLKLIEKYFGTLPAKNPPKPTP---VPLPPAELTGPEVMEQ
PF00675         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTK
PF05193         AHISLAFEGPPIPLPDS-AALYLLQEILGGGMSSRLFQELREKKGLAYSVSAFFDSYEDAGLFTISVQTN
PF00675         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KENTNEALALVREIVAKYVAEGPTDAELRAAKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05193         PEDLEEALEEVLSELEELTKNGISEEELERAKN-------------------------------------
PF00675         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05193         ----------------------------------
PF00675         ----------------------------------