[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07569.1

[Show Plain Result]


## Summary of Sequence Search
    1::224
    1::82      5e-14  51%   83 aa  PF01713 Smr "Smr domain"
    1::224

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01713         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVD
PF01713         --------------------------------------------------------------------LD


                         +         .         .         .         .         *         .:210
query           LHGLRSDEAREALANFLRRSVRNGVRCVRVIHGKGIGSPDKLPVLKGKVRSWLVQKEEVIAFVQARESQG
PF01713         LHGLTVEEALEALEEFLDQAELKGIRCVLVIHGK--GNHSKGGVLRKAVRKWLKEGPEVLAFHDASPREG


                         .         .         .         +         .         .         .:280
query           GAGALMVLLxxxxx
PF01713         GPGATYVTL-----