[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07698.1

[Show Plain Result]


## Summary of Sequence Search
    1::115
    4::91      3e-20  58%   91 aa  PF00254 FKBP_C "FKBP-type peptidyl-prolyl cis-trans isomerase"
    1::115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDE
PF00254         ---------------------KKGDTVTVHYTGKL----EDGTVFDSSYDRGEPLEFIVGSGQVIPGLEE


                         .         .         *         .         .         .         .:140
query           GVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLxx
PF00254         ALLGMKVGEKRTVTIPPELAYGERGVAGKIPPNATLIFEVELV--