[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07717.1

[Show Plain Result]


## Summary of Sequence Search
    1::884
    1::535       0.0  62%  546 aa  PF01411 tRNA-synt_2c "tRNA synthetases class II (A)"
    1::43      1e-07  55%   44 aa  PF07973 tRNA_SAD "Threonyl and Alanyl tRNA synthetase second
    1::67      1e-06  42%   67 aa  PF02272 DHHA1 "DHHA1 domain"
    1::884

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
PF01411         --------------EIRQKFLDFFESKGHTVVPSSSLVPRNDPTLLFTNAGMNQFKPYFLGTEKPPYKRA
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPADKLWVTVYA
PF01411         TNSQKCIRAG----DLENVGKTARHHTFFEMLGNFSFGDYFKEEAIEWAWELLTEVLGLPKERLYVTVFE
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMADTGPCGPCSEIFYDHGPDVWXXXXXXXXXX
PF01411         GDDEAYDIWEKLVGVPEERILRFGKK-------DNFWEMGDTGPCGPCSEIHYDRGPEIGGGPPGSLVNA
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXRYIEIWNLVFMQFNRDEQGTMTPLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQALIKGAGRETHIA
PF01411         DDRYLEIWNLVFMQFNRDADGSLEPLPKKNIDTGMGLERLAAVLQGVRSNYDTDLFRPIIKATGKKYGDD
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DLNQNSLKVIADHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGE
PF01411         DEIDVAYRVIADHIRTLTFAIADGVLPSNEGRGYVLRRILRRAVRYGKKLGIKEPFLYKLVPVVVEIMGD
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AYPELAEAQSRVVEVLKAEEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQD
PF01411         AYPELKEKQDFIKEVLKEEEERFLKTLERGLKLLEKLIAKLKK--GKVLSGEDAFKLYDTYGFPLDLTEE
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VAREQEITVDEAAFDAAMTRQREQARAAGKFKMAAGLEYSGEKTVFHGYDALSMDGVRVTALYVDGASVD
PF01411         IAEERGLTVDEEGFEAAMEEQRERARAAAKKK---GMELDKETTEFLGYDTLEAE-AKVLALFKDGEFVD
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TMQPGQSGVVVLDNTPFYAESGGQVGDQGTLVSGPAVFAVADTTKIQSDVFGHQGTLANGALKVGxxxxx
PF01411         SVKAGEEGGVVLDRTPFYAESGGQVGDTGTITGDGGVFEVTDVQKV-GGVILHIGEVEEGSLKVG-----
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01411         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVRVLSIGTSKELCGGTHVTRTGDIGLFKIVVEAGVAAG
PF01411         ----------------------------------------------------------------------
PF07973         --------------------------------VRVVSIGESVDLCGGTHVPNTGEIGAFKLLRGDEKNAG
PF02272         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           IRRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01411         ----------------------------------------------------------------------
PF07973         LQRI------------------------------------------------------------------
PF02272         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSAAIVLAAVADGKVSLIAGVTADATSKVKAGEL
PF01411         ----------------------------------------------------------------------
PF07973         ----------------------------------------------------------------------
PF02272         -------------------------------------ASPVIVFAEEDGKVK----GSARSIKGVDVREL


                         +         .         .         .         .         *         .:910
query           VNFVAQQVGGKGGGRPDMAQAGGTDPANLPKALAGVTExxxxxx
PF01411         --------------------------------------------
PF07973         --------------------------------------------
PF02272         LKEVAPLLGGGGGGHPDAAGAGGKDPDKLDEALEALAE------