[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07787.1

[Show Plain Result]


## Summary of Sequence Search
    1::236
    1::47      2e-05  38%   47 aa  PF00440 TetR_N "Bacterial regulatory proteins, tetR family"
    1::236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxILDVSLRLFNELGEPNVTTTTIAEAMEISPGNLYYHFRNKDDIINSIxxxxxxxx
PF00440         ---------------ILDAALRLFAERGYEATSVRDIAAAAGVSKGTFYRHFGSKEALLEAL--------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00440         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00440         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
PF00440         --------------------------