[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07796.1

[Show Plain Result]


## Summary of Sequence Search
    1::188
    6::54      7e-07  43%   54 aa  PF08281 Sigma70_r4_2 "Sigma-70, region 4"
    1::188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08281         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQEIQRLPTRQRE
PF08281         ----------------------------------------------------------EALEELPERQRE


                         +         .         .         .         .         *         .:210
query           AFLMRYWEDMDVAETAAVMGCSEGSVKTHCSRATHTLxxxxxxxxxxx
PF08281         VLLLRYLEGLSYEEIAEILGISEGTVKSRLHRARKKL-----------