[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07810.1

[Show Plain Result]


## Summary of Sequence Search
    1::334
    1::118     4e-21  46%  128 aa  PF00107 ADH_zinc_N "Zinc-binding dehydrogenase"
    1::58      2e-05  52%  108 aa  PF08240 ADH_N "Alcohol dehydrogenase GroES-like domain"
    1::334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDLPGLEVAGVVV
PF00107         ----------------------------------------------------------------------
PF08240         --------------------------AGEVLVKVKAAGICGSDLHIRRG-YPPPPKFPRILGHEGAGVVV


                         .         .         *         .         .         .         .:140
query           GGDLSHPANRFGLKAGDRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ----------------------------------------------------------------------
PF08240         ----AVGPGVTGLKVGDRV---------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxGIGTTAIQIAKALGFKVFVTAGSDDKCKACESLGADRAINYKTQDFVAEVK
PF00107         -------------------GVGLAAIQLAKALGARVIAVDRSPEKLELAKELGADHVINYKDEDFVEAVK
PF08240         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ALTEGKGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRxxxx
PF00107         ELTGGRGVDVVLDCVSGATLEAALELLRPGGRVVLVGVPSGGPVTLPLGPLILKEITIRGSFLGSR----
PF08240         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00107         ------------------------------------------------------
PF08240         ------------------------------------------------------