[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07859.1

[Show Plain Result]


## Summary of Sequence Search
    1::259
    3::170     1e-23  36%  170 aa  PF00378 ECH "Enoyl-CoA hydratase/isomerase family"
    1::259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxLTISNPEARNALHPDIYXXXXXXXXXXXRDDSIRAVILTGADGVFCAGGNLNRLL
PF00378         ---------------ITLNRPEKLNALSPEMLDELAAALDEAEADPDVRVVVLTGAGKAFCAGADLKEL-


                         .         .         *         .         .         .         .:140
query           GNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLACDFVVAASDAKFVMAYVKVGL
PF00378         --AEAGPEAEARAFRRLQRLFRRIETLPKPVIAAVNGAALGGGLELALACDIRIAAEDAKFGLPEVKLGL


                         +         .         .         .         .         *         .:210
query           TPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIVNRVAAxxxxxxxxxxxxxxxxxxxxxxxxx
PF00378         FPGAGGTQRLPRLVGPARARELLLTGRRISAEEALALGLVDEVVA-------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00378         -------------------------------------------------