[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07913.1

[Show Plain Result]


## Summary of Sequence Search
    1::113
    1::92      1e-15  40%   92 aa  PF01521 Fe-S_biosyn "Iron-sulphur cluster biosynthesis"
    1::113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxISMTEKAAKHVARYLEXXXXXXXXXXXXXXXXCSGLAYKLEYVDEVLPEDQVFETHGIKVIV
PF01521         --------ITITDAAAKRLKELLQEGNPDLGLRVGVKSGGCSGFQYGMSLDDEIDEDDTVFEADGVKVVV


                         .         .         *         .         .         .         .:140
query           DPKSLPYIDGTELDFAREGLNEGFKFNNPxxxxxxxxxxxxxx
PF01521         DPKSLEYLDGSTVDYVEELIGSGFKFTNP--------------