[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07921.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
   40::167     4e-06  34%  169 aa  PF00106 adh_short "short chain dehydrogenase"
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELEAEATASGVRVAWHLQDLSQPGP
PF00106         ---------------------------------------------ELAAELEAAGGRVIAVQLDVTD---


                         .         .         *         .         .         .         .:140
query           SAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNLVTPMTMTGAFIEHTVRFDCP
PF00106         EASVEALVEEVVEEFGRLDILVNNAGIAGD-GPLEDLTEEDFDRVFDVNLLGPFLLTQAALPLMLARGGG


                         +         .         .         .         .         *         .:210
query           RKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         R-IVNISSVAGLLGSPGQAAYAASKAALNGLTRSLAAE--------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         ----------------------------------------------