[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07939.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
   19::257     4e-37  41%  278 aa  PF00793 DAHP_synth_1 "DAHP synthetase I family"
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSFRGLGME
PF00793         -------IGEDDRLLVIAGPCSIEDEEAALEYAERLKALGEKLKLLIVMRAYFEKP-RTSPVGFKGLGND


                         .         .         *         .         .         .         .:140
query           KGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
PF00793         PGLDILFEIKEGLGLPVATEV--LDPIQPVADLVDWLQIGARTTESQDHREAASGLSKPVGFKNGTDVAI


                         +         .         .         .         .         *         .:210
query           HDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRSLAIMRETGAPVVFDATHSVQLPGGQG
PF00793         DAMLAAAEK----HHFLGVGTDGNILCERGLRGGYNYLVLDLAALPIMLETHLPVIVDPSHA------NS


                         .         .         .         +         .         .         .:280
query           TSSGGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMSDGPNAVxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00793         GKDGGRQPLVAPLARAAIAAGIDGLMIESHLDPGNALSDGPQAL--------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
PF00793         ---------