[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF07996.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
   16::248     9e-33  42%  249 aa  PF02784 Orn_Arg_deC_N "Pyridoxal-dependent decarboxylase, pyridoxal
  191::246     4e-04  34%  285 aa  PF01116 F_bP_aldolase "Fructose-bisphosphate aldolase class-II"
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEQCALYYAVKANSDAPVLRALLGVADGFE
PF02784         ----------------------------------------PRDYQVYYAVKANSNPAVLRLLAEEGLGLD
PF01116         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRA
PF02784         VASKGELERA--LAAGVPIIFSGPNKDDEELRLALEAGVVLIVVDSLDELERLAELAPELGVKARVGLRV
PF01116         -----DFERLKEIQEAVGVPLGGSGVPDEEIREAIKYGVRKINIDTDLQLAFTDAVRK------------


                         +         .         .         .         .         *         .:210
query           NPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA
PF02784         NP--GVSAGTISTGGEDSKFGLTLEEAPEALERAKEL-GLELVGLHFHIGSQITDPEPFVQALEEALRLF
PF01116         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAxxxxxxx
PF02784         DELREL-GIPLKFLDLGGGLGIDY---DGDYDLEEYADAIVAALEELCPGPRIIIEPGRAIVA-------
PF01116         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02784         ----------------------------------------------------------------------
PF01116         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02784         -----------------------------------------------
PF01116         -----------------------------------------------