[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08007.1

[Show Plain Result]


## Summary of Sequence Search
    1::1044
    1::1014      0.0  39% 1014 aa  PF00873 ACR_tran "AcrB/AcrD/AcrF family"
   80::274     5e-05  30%  284 aa  PF03176 MMPL "MMPL family"
  455::527     6e-05  29%  610 aa  PF02460 Patched "Patched family"
    1::1044

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMH
PF00873         LSRFFIRRPVLALLLALLLLLAGLLALFKLPVEEFPDITPPQVTVSTSYPGASPEEVEELVTKPLERALN
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVS
PF00873         GIPGVKYIRSTSSEGLSSITVEFKDGTDIDEALVDVQNKLNAARSRLPEGVEEPGVGPDSTSDVPILVLA
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAEYALRVWFNPDQLNAYGLTTADVEAAIRARN
PF00873         LTSDGYDLAE--LRDYADWNLRDELERVPGVGEVDIFGGEREIRVELDPDKLAAYGLTLADVANALRAQN
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GSVTPGQLGGAPSKPGQSYQAVVRPPAPLADPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTL
PF00873         VNVPAGSIEGG----GQEY--LVRANGRLKSAEDLENIVVKNR-DGRPVRLGDVATVEDGPEDRRGIARF
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NGREAASMGLKLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLV
PF00873         NGKPAVGLAVAKRPGANALEVADAVKAKLEELQASLPAGVEITVTYDQSEFIRASINEVVKTLLEAILLV
PF03176         ------------------------IRDAVAEALP--PAGVTVYVTGPAA--IAADLNDAILLLAEALLLI
PF02460         -----------------------------------------------------SIVPSTLQNLGIALAAI


                         .         .         .         .         *         .         .:420
query           FLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
PF00873         VLVLFLFLGNWRATLIVALAIPLSLLGTFAVMYLFGFSLNLLSLFALILAIGILVDDAIVVVENIHRHL-
PF03176         LLLLLLVFRSLVAPLLPLLTVLLSLLAALGLVLGLGIGLSSFTVLAFVLLLGLGVDYAIFLVSRYREEL-
PF02460         FLVTLLLLPNPLSALIVTLTVASIDVGVFGFMALWGVSLNAVSMVNLIMSIGFSVD--------------


                         .         .         +         .         .         .         .:490
query           EEGVDAFTAASRSMREVSGXXXXXXXXXXXXXXPMAFLGSAVGVIYRHFAMTLAISIAFSLFFALSLAPA
PF00873         EEGLSPLEAAIKAAKEVGGPVIASTLTTIAVFLPLAFLSGITGELFRPFAITVAIALLASLLVALTLTPA
PF03176         AAGGDREEAVRRALRTTGRAITFAALTVAIGF--AALLFSPIPFL-RQLGLALAIGVLLAALVVLTLLPA
PF02460         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           MCASLLRHGAQPARGPLAWFEHRFTAFTTRYAGWVXXXXXXXXXXXAVYLAMAAVCAVGLWQLPSGFLPE
PF00873         LAALLLKPKKKEEHGRFRWFNRLFDRLTRRYRRLLRWALRHRKLVLLVALLLLVLSLLLFPRVPTEFFPE
PF03176         LLVLLGR---------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKTSFALLGWNSGGSGEQRASVFLSLDDWKLR
PF00873         EDEGEFQVMVELPPGTSLEETDAVLQQVEKILK-EVPEVESVFSYVGRAFAGAGPNSGEIFVNLKPWDER
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GRENAADVVLARLTKGLEEWPGRGDAQLYPYNGTALPELGSTSGLDMRLVTRLEGGRPSLYAARDKLIER
PF00873         DR--SSDEIIARLREALAKIPG---ARVFVFQPPDIRGLGLGPGVRAPIQIKLYGDLEELRAAAEQLEAA
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AKADPVFAEVRATAGQPVPALDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQAD
PF00873         LRQVPGLVDVRDDLQEGGPELRIDIDREKAARLGVSVADVAQTLRTALGGRYVGTFREGGRRYPVVVRLP
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           APFRMQPEDLARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLES
PF00873         EEYRSSPEDLENLPVRTPSGQMVPLSAVATIEETTGPPSINRENGRRVVTVSADVAPGDSLGEALAAIEE
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           LVRELGPDYEVRWSGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASAV
PF00873         LAAELPPGYSIEWGGEAEEQQEAFASLGLAFPLALLLIYLLLAAQFESFSQPLIILLTVPLALIGALLGL
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           WLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLEXXXXXXXXXXXXXXPVVMTSLAFILGVV
PF00873         LLTGLPFSVYSMIGFIALAGIVVKNAILLVDFANQLRREGMSLREAIIEAARLRLRPILMTALATILGLL
PF03176         ----------------------------------------------------------------------
PF02460         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           PLAISTGPGAGAQRAVGTGVLGGMLGATILGTLVIPLLYAWIAxxxxxxxxxxxxxxxxxxxxx
PF00873         PLALGTGAGAEIRQPLAIAVIGGLLFSTLLTLFVVPVLYVLLA---------------------
PF03176         ----------------------------------------------------------------
PF02460         ----------------------------------------------------------------