[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08055.1

[Show Plain Result]


## Summary of Sequence Search
    1::243
    1::149     2e-41  56%  156 aa  PF01625 PMSR "Peptide methionine sulfoxide reductase"
    1::243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxETAVFAGGCFWG
PF01625         ----------------------------------------------------------ETAYFAGGCFWG


                         .         .         *         .         .         .         .:140
query           VQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQL
PF01625         VEHEFWELPGVLSTRVGYAGGHTPNPTYEEVCSGKTGHAEVVRVTYDPSKISYEELLDVFWEI-HDPTQL


                         +         .         .         .         .         *         .:210
query           NYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSx
PF01625         NRQGNDRGTQYRSAIFYHNEEQKAIAEASKEALQAS-AGGKPIVTEIEPAKPFYPAEEYHQDYLKKNPN-


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01625         ---------------------------------