[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08099.1

[Show Plain Result]


## Summary of Sequence Search
    1::358
    1::287     1e-67  51%  290 aa  PF01180 DHO_dh "Dihydroorotate dehydrogenase"
   19::133     8e-04  31%  159 aa  PF11187 DUF2974 "Protein of unknown function (DUF2974)"
    1::358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDPRTVMGVR
PF01180         -------------------------------------------------------------DSVEVFGLK
PF11187         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
PF01180         FPNPVGLAAGLDKNGEAIDALFDLGFGFVEVKTVTPEPQPGNPKPRLFRLPEGEALINRMGLNNPGLDAV
PF11187         -----------------------------------------------FRLPNGTYVVAFRGTDDSIVD--


                         +         .         .         .         .         *         .:210
query           IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
PF01180         LERLR-PRKREYPGDLGIIISKNGST--EDAAEDYVECAEKLEPGADALELNISCPNTPGLRALGQDPEL
PF11187         --------WKED-----FNMAFGYEIPQQKQALAYLKKIAKAYPGAIIITGHSLGGNLAQYAALALSPDL


                         .         .         .         +         .         .         .:280
query           DSLLSTLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIATNTTISRDAVKGLPHA
PF01180         VELLTA--------AVKEATKVPVLVKLAPDLTDIELIAIAAEAGADGVDGINATNTTLSRDILETLPPG
PF11187         QDRISTKSAGYQRIKDRIKKYVP-----------------------------------------------


                         .         *         .         .         .         .         +:350
query           EEAGGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVR
PF01180         NETGGLSGPALKPIALRMVAELRKALGGDIPIIGVGGIESGEDALEFILAGASAVQVYTALIYEGPGLVK
PF11187         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ECASALxx
PF01180         EIKKGL--
PF11187         --------