[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08260.1

[Show Plain Result]


## Summary of Sequence Search
    1::305
    2::144     2e-07  32%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxIAVPLNVVFGVAAAWAIAKFDFRGKNLLITLIDLPFSVSPVISGLIY
PF00528         -----------------------LAVPLGILLAL-------RRNSRLRRLLRFLVLLPRAIPSLVLALLL


                         +         .         .         .         .         *         .:210
query           VLMFGAQGWFGPWLEAHDIKIMFAVPGIVLATIFVTFPFVARELIPLMQAQGSEEEEAAIVLGASGWQTF
PF00528         LLLF-AIGLGGGWILGL-LGLGHGLLAVILALVLSTAPFVRLIRRAALESIPKDLIEAARALGASRWQTF


                         .         .         .         +         .         .         .:280
query           WHVTLPNIRWGLLYGVILCNARAMGEFGAVSVVSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         RRVILPLALPGIITGLILAFIGALGEFVIAELLGG-----------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         -------------------------