[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08451.1

[Show Plain Result]


## Summary of Sequence Search
    1::139
    1::109     9e-14  36%  111 aa  PF08448 PAS_4 "PAS fold"
    6::112     3e-11  34%  112 aa  PF00989 PAS "PAS fold"
    1::139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA
PF08448         -----------LDSLPDGVFVLDADGRILYANPAAERLLGYSPEELIGRTLAELLPEEDAAELRAALRRA
PF00989         ----------LLESAPDGIIVTDEDGRILYVNPAAERLLGYSREELIGKSLSDLLPPEDDRELVEALREA


                         .         .         *         .         .         .         .:140
query           IDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVTDKxxxxxxxxxxxxxxx
PF08448         LAGGEP-VEEEEELVRA---DGERRWVEVSAVPLRDEDGRVVGVVGVARDITER---------------
PF00989         LEQG-GEVRGEEV---NLRKDGSPFWVELSASPVRDEGGEVTGFVGVFRDL------------------