[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08549.1

[Show Plain Result]


## Summary of Sequence Search
    1::341
   47::141     8e-19  48%  160 aa  PF03050 Transposase_25 "Transposase IS66 family "
    1::341

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYSLSLRDLEEMMAERGLAVDHSMVHRWVIKLLPLFEKA
PF03050         --------------------------------YHLSLRRQEELLAERGIEVSHSTLARWVGKFAPLLEPL


                         .         .         *         .         .         .         .:140
query           FRRHKRSVSKSWRMDETYLKVRGKWAYLYRAVDKAGNTIDFLLCARRDKVAARRYxxxxxxxxxxxxxxx
PF03050         YDALRRELSDVWHADETPVKVLGKKGYLWVAVDSTGPVVDFHLSPSRDGKAAKRF---------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03050         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03050         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03050         -------------------------------------------------------------