[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08555.1

[Show Plain Result]


## Summary of Sequence Search
    1::1093
    1::686     8e-52  46%  690 aa  PF10101 DUF2339 "Predicted membrane protein (DUF2339)"
    1::1093

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGGNSVARVGILILFFGVA
PF10101         ---------------------------------------------------LGGNWLVRVGGLVLLLGVA


                         .         .         .         +         .         .         .:280
query           FLLKYAADNSILPVEFXXXXXXXXXXXXXXXXXXXXTRRPGYALAVQGAGVGVLYLTVFAAARLYDLLPA
PF10101         FLLKYAIEAGLLGPEVRVALGALLGLALLAAGEWLRRRRAAFALVLQGGGIAVLYLTVFAAFKLYGLIPP


                         .         *         .         .         .         .         +:350
query           GAAFALMVLVCGLAAGLAILQNASVLAVTGSAGGFLAPVLISTGGGSHVMLFSYYALLNTGIFVIAWFRA
PF10101         GAAFALLVLIALLGVGLALRQGPA-LAVLGLLGGFLAPLLLSTGSGNPVALFGYLALLNAGALALAWKKR


                         .         .         .         .         *         .         .:420
query           WRVLNLLGFVFTFGIATLWGVLSYKPALLSTTEPFLILFFLLYTGIALLYALRRSVQLTGYVDGTLIFGT
PF10101         WRWLNLLAFVGTFLWALLWLALAY-TALFATTQPFLLLFLLLFLAILLLPALRWRRE-PALVDGTLLFGL


                         .         .         +         .         .         .         .:490
query           PLAMAGLQAALMRGTPFGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIFATLAIPLGFDGR
PF10101         PLVAFALQALLV---DFALAWSALALAALYLALALLLARRRLRLSLLAALLLALALAFATLAIPLALSGR


                         *         .         .         .         .         +         .:560
query           TTCAVWALEGAGVVWIAMRQQRRLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         WTALVWALEGALLLWLGLKQKRRL----------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF10101         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           IWLNAVLLRTLHHWQGVPYTLHDLAGSTLVQASLSVFWXXXXXXXXXXXXXXXXXSLWLVGGGLLAVTVM
PF10101         LWLTLEVRRLWHGYGGL--------DSGLEQYSYSILWLLLALALMVLGIRRGSRLLRRAGLALLALVVL


                         .         .         .         .         *         .         .:1120
query           KMFLVDLSFLSGVARIVSFIAVGGLLLLIGYxxxxxxxxxxxx
PF10101         KLFLVDLSGLEGLARIVSFIGLGLLLLGIGY------------