[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08608.1

[Show Plain Result]


## Summary of Sequence Search
    1::405
    1::189     2e-37  42%  189 aa  PF02515 CoA_transf_3 "CoA-transferase family III"
    1::405

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02515         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRALRPDIIYCSVTGFGPDGPYA
PF02515         -----VTLDLKTPEGREILRRLIAEADVLVENFRPGVLERLGLGYETLRAINPRLIYASISGFGQTGPYA


                         +         .         .         .         .         *         .:210
query           PRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDILTGLYASVALMGALYHRQATGEGQFXXXXX
PF02515         DRPGYDLVAQAASGLASLTGEPDG----PPVRPGVPIGDSATGLHAAIGILAALLHRERTGRGQHVDVSL


                         .         .         .         +         .         .         .:280
query           XXXXXXXNGHLALGYHMTGKVPQRAGNSNPVASPSEVFACLDGHVIIAAGNNGQFAALxxxxxxxxxxxx
PF02515         LDAVLALLSNLLADYLAGGAVPPREGNAHPGIPPYGVYRTADGWIALAALNDRQWRRL------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02515         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02515         -------------------------------------------------------