[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08673.1

[Show Plain Result]


## Summary of Sequence Search
    1::388
   50::176     1e-07  28%  177 aa  PF02687 FtsX "Predicted permease"
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02687         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02687         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02687         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAFINILGLTLTTIFSVAAMIGAMITMYAS
PF02687         -----------------------------------------ASLSLILLLLAVLLLLVAALVIANTLLLS


                         .         *         .         .         .         .         +:350
query           VANRVGEIGTLRALGFQRINVLAAFLIEXXXXXXXXXXXXXXCASLMQFASFSTTNFQTFADLSFRFVLT
PF02687         VRERRREIGILKALGASKRQIRRQFLLEGLLLGLLGGLLGILLGLLLSLL-LSSLLLSLYLSLSLPISLS


                         .         .         .         .         *         .         .:420
query           PGIVIKTLLFSMTMGLIGGFLPALRASRLxxxxxxxxx
PF02687         PAALLLALLLALLLGLLAGLLPARRALRL---------