[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08678.1

[Show Plain Result]


## Summary of Sequence Search
    1::121
    1::45      8e-07  53%   47 aa  PF01022 HTH_5 "Bacterial regulatory protein, arsR family"
    3::53      9e-05  37%   63 aa  PF01978 TrmB "Sugar-specific transcriptional regulator TrmB"
    1::121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxLADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKxx
PF01022         -------------------DPTRLRILRLLAEGELCVGELAEALGLSQSTVSQHLKVLREAGLV------
PF01978         -----------------LSEYEAKVYLALLKNGPLTAREIAKELGIPRSTVYEVLKKLEEKGLVEREK--


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01022         ---------------------------------------------------
PF01978         ---------------------------------------------------