[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08687.1

[Show Plain Result]


## Summary of Sequence Search
    1::564
    2::61      3e-10  46%  238 aa  PF00483 NTP_transferase "Nucleotidyl transferase"
   72::155     1e-06  37%  176 aa  PF00463 ICL "Isocitrate lyase family"
    1::564

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLAD
PF00483         ----------------------------------------------------------------------
PF00463         ---------------LPIIADADTGFGGALNVYRLAKLMIEAGAAGIHIEDQVSEKKCGHLGG--KVLVP


                         +         .         .         .         .         *         .:210
query           IDEFCGKIKAGKDSQADDDFSIVARVEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         ----------------------------------------------------------------------
PF00463         TEEHIARLVAARADVMGVDTVIVARTDA------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGI
PF00483         --------------------------AVILAGGLGTRLRPLTRERPKKLLPVGGKPLIQYTLERLAAAGI
PF00463         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NDITVVGGYKAEAIDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         EEIVVVTGYHKESIE-------------------------------------------------------
PF00463         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00483         ----------------------------------------------------------------------
PF00463         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxx
PF00483         ----
PF00463         ----