[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08754.1

[Show Plain Result]


## Summary of Sequence Search
    1::183
   23::119     1e-05  35%  133 aa  PF04290 DctQ "Tripartite ATP-independent periplasmic transporters,
    1::183

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDIVAWLCAASAFLILGQTFQ
PF04290         -------------------------------------------------EELARYLFAWLVFLGAAYAVR


                         .         .         *         .         .         .         .:140
query           HGGIVRVEMLLEAVGTKRRWLLEVISLTICLIFAGYAAWALGSFAWQSWDIGDVSQGQIVIPLWIPQSFA
PF04290         TGGHVRVDLLYNRLPPRARRLLDLLGLLLCLAFAGLLAWGGWDFVLAALRGGETSPA-LGIPLWIPVGFA


                         +         .         .         .         .         *         .:210
query           VIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04290         LL-----------------------------------------