[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08812.1

[Show Plain Result]


## Summary of Sequence Search
    1::316
    7::195     4e-08  31%  195 aa  PF00528 BPD_transp_1 "Binding-protein-dependent transport system
    1::316

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00528         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGFVAGYLRDSVPDRVASFLSVLGVS
PF00528         ---------------------------------------------GILLALRRNSRLRRLLRFLVLLPRA


                         +         .         .         .         .         *         .:210
query           IPHYWLGMVLVIAFSVLLGWLPATGAGPNGSGDWGWDWEHIQYMLLPAVTMSVIPMGIVARTIRALVAEI
PF00528         IPSLVLALLLLLLFAIGLG------------GGWILGLLGLGHGLLAVILALVLSTAPFVRLIRRAALES


                         .         .         .         +         .         .         .:280
query           LSNEFIAGLRARGLSDLAVFRHVVKNVTPTALSVMGLQLGYLLGGSILIETVFSWPGTGFLLNSAIFQRD
PF00528         IPKDLIEAARALGASRWQTFRRVILPLALPGI-ITGLILAFILGEFVIAELLGGGPGLGSLLLLALLGYD


                         .         *         .         .         .         .         +:350
query           FPLLQGTILVLAVFFVMLNLLVDALQTLFDPRIQxx
PF00528         YNLVMGAAAALALLLLLLNLLADLLQRYLDPLLR--